BLASTX nr result
ID: Anemarrhena21_contig00045078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00045078 (266 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63162.1| RNase H family protein [Asparagus officinalis] 75 2e-11 gb|ABD63139.1| Reverse transcriptase family protein [Asparagus o... 75 2e-11 gb|ABD63088.1| hypothetical protein 17.t00015 [Asparagus officin... 70 7e-10 gb|ABD63198.1| gag/pol polyprotein, related [Asparagus officinalis] 56 8e-06 >gb|ABD63162.1| RNase H family protein [Asparagus officinalis] Length = 1189 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/61 (55%), Positives = 43/61 (70%) Frame = +2 Query: 80 PKGKPIDYYHMTRRGLGYVTPPCLSDNEVELAANGSHSSDTESWDSDVSVGEVFRNLSVN 259 P+GKP DYY T RG+GYVTPP S+NE+ HSS S++SDVS+G F+NL+VN Sbjct: 5 PEGKPPDYYQKTGRGMGYVTPPPASENEISNYLRHDHSSGISSYESDVSIGPFFKNLTVN 64 Query: 260 M 262 M Sbjct: 65 M 65 >gb|ABD63139.1| Reverse transcriptase family protein [Asparagus officinalis] Length = 1181 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/63 (57%), Positives = 45/63 (71%) Frame = +2 Query: 77 APKGKPIDYYHMTRRGLGYVTPPCLSDNEVELAANGSHSSDTESWDSDVSVGEVFRNLSV 256 AP+GKP DYYH TR GLGYVT P S++E+ +HSS S +SDVSVG F++L+V Sbjct: 508 APEGKPQDYYHKTRSGLGYVTTPSASEDEISNYLGQNHSSRISSCESDVSVGLFFKSLTV 567 Query: 257 NMT 265 NMT Sbjct: 568 NMT 570 >gb|ABD63088.1| hypothetical protein 17.t00015 [Asparagus officinalis] Length = 125 Score = 69.7 bits (169), Expect = 7e-10 Identities = 38/92 (41%), Positives = 48/92 (52%), Gaps = 4/92 (4%) Frame = +2 Query: 2 KMGYDF-QXXXXXXXXXXXXXXAQPKAPKGKPIDYYHMTRRGLGYVTPP---CLSDNEVE 169 K+GYDF + P+GKP DYYH T RGLGY +PP C E Sbjct: 7 KIGYDFTRKEGLNFGKGRKIPIKHVYVPEGKPEDYYHKTHRGLGYESPPLIWCFEATEES 66 Query: 170 LAANGSHSSDTESWDSDVSVGEVFRNLSVNMT 265 + + SS++ WDSDVS G VF+ L +NMT Sbjct: 67 EGSFTNSSSESNYWDSDVSTGAVFKELMINMT 98 >gb|ABD63198.1| gag/pol polyprotein, related [Asparagus officinalis] Length = 313 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 4/65 (6%) Frame = +2 Query: 80 PKGKPIDYYHMTRRGLGYVTPP----CLSDNEVELAANGSHSSDTESWDSDVSVGEVFRN 247 PKG+P Y+ +RRGLGY + C + A + SS + +WDSDVSVG++F++ Sbjct: 9 PKGRPSKYFSKSRRGLGYASSSSELCCNISEDSGGARSDDQSSTSSAWDSDVSVGDLFKD 68 Query: 248 LSVNM 262 L VNM Sbjct: 69 LIVNM 73