BLASTX nr result
ID: Anemarrhena21_contig00044761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00044761 (330 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63151.1| hypothetical protein 20.t00003 [Asparagus officin... 78 3e-12 gb|ABB55338.1| hypothetical protein 16.t00009 [Asparagus officin... 78 3e-12 gb|ABB55315.1| dna-directed rna polymerase ii - related [Asparag... 65 1e-08 gb|ABD63174.1| hypothetical protein 20.t00026 [Asparagus officin... 64 3e-08 gb|ABD63154.1| hypothetical protein 20.t00006 [Asparagus officin... 61 3e-07 >gb|ABD63151.1| hypothetical protein 20.t00003 [Asparagus officinalis] Length = 1011 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/67 (52%), Positives = 42/67 (62%) Frame = -2 Query: 281 GCLNWLINIHPRYLVWRCESTCYVEPYLPCHFAH*FGYD*LYIGNPSPTLGHEGALSMVL 102 GC NWL+NI YL +R + C++EPYLPC FAH FGYD LY+GNP L G L L Sbjct: 569 GCFNWLVNISLGYLTFRVRNQCFIEPYLPCRFAHQFGYDQLYVGNPRQQLRTHGGLVEGL 628 Query: 101 ALGIGTV 81 + TV Sbjct: 629 RTWLWTV 635 >gb|ABB55338.1| hypothetical protein 16.t00009 [Asparagus officinalis] Length = 1322 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/67 (52%), Positives = 42/67 (62%) Frame = -2 Query: 281 GCLNWLINIHPRYLVWRCESTCYVEPYLPCHFAH*FGYD*LYIGNPSPTLGHEGALSMVL 102 GC NWL+NI P YL +R + C++EPYLPC FA FGYD LY+GNP L G L L Sbjct: 680 GCFNWLVNIRPGYLTFRVGNQCFIEPYLPCRFARQFGYDQLYVGNPRQQLRAHGGLVDGL 739 Query: 101 ALGIGTV 81 + TV Sbjct: 740 RAWLWTV 746 >gb|ABB55315.1| dna-directed rna polymerase ii - related [Asparagus officinalis] Length = 702 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = -2 Query: 290 LFEGCLNWLINIHPRYLVWRCESTCYVEPYLPCHFAH*FGYD*LYIGNPSPTLGH 126 L G WLI+I P YL++R C++EPY P F+ FGYD LY+GNP+PTL + Sbjct: 70 LSRGVFWWLISIRPGYLIFRQGRKCFIEPYQPYRFSRQFGYDQLYVGNPNPTLAY 124 >gb|ABD63174.1| hypothetical protein 20.t00026 [Asparagus officinalis] Length = 903 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/60 (51%), Positives = 38/60 (63%), Gaps = 5/60 (8%) Frame = -2 Query: 281 GCLNWLINIHPRYLVWRCESTCYVEPYLPCHFAH*FGYD*LYIGNPSPTLG-----HEGA 117 G +WL++I P YL++R C+VEPY P FA FGYD LYIGNP P L +EGA Sbjct: 108 GVFHWLLSIRPGYLIFRQGVNCFVEPYQPYRFARQFGYDQLYIGNPRPQLSVIDNLYEGA 167 >gb|ABD63154.1| hypothetical protein 20.t00006 [Asparagus officinalis] Length = 851 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/67 (46%), Positives = 39/67 (58%) Frame = -2 Query: 314 FDGRSGSGLFEGCLNWLINIHPRYLVWRCESTCYVEPYLPCHFAH*FGYD*LYIGNPSPT 135 F+G S L EG +WL+ I YLV+R +EPY+P FA F YD LY+GNP+P Sbjct: 462 FEG--SSSLEEGTFSWLLMIRLGYLVYRSREKYIIEPYMPSRFARQFVYDQLYVGNPNPA 519 Query: 134 LGHEGAL 114 L G L Sbjct: 520 LAQIGNL 526