BLASTX nr result
ID: Anemarrhena21_contig00044697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00044697 (316 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010929744.1| PREDICTED: putative pentatricopeptide repeat... 79 9e-13 ref|XP_008794975.1| PREDICTED: putative pentatricopeptide repeat... 79 2e-12 ref|XP_009413568.1| PREDICTED: putative pentatricopeptide repeat... 70 7e-10 >ref|XP_010929744.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25060, mitochondrial [Elaeis guineensis] Length = 680 Score = 79.3 bits (194), Expect = 9e-13 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = -2 Query: 177 DPKTLAKIHALLILTGSLSHPQYPGHLIAAYSRFNNISAAHSVFVTIPQPTISAYNSLI 1 DP+TLA+IHAL+ILTGSLSHPQ PG LIAAY+R +I+AA SVF T +S +NSLI Sbjct: 20 DPQTLAQIHALVILTGSLSHPQSPGRLIAAYARLGDIAAAQSVFKTTSSHNVSTWNSLI 78 >ref|XP_008794975.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25060, mitochondrial [Phoenix dactylifera] Length = 680 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/63 (60%), Positives = 48/63 (76%) Frame = -2 Query: 189 TSIGDPKTLAKIHALLILTGSLSHPQYPGHLIAAYSRFNNISAAHSVFVTIPQPTISAYN 10 ++ GDP LA+IHAL+IL GSLSHPQ PG LIAAY+R +I+AA SVF T P +S +N Sbjct: 16 STCGDPHILAQIHALMILNGSLSHPQSPGRLIAAYARLGDIAAAQSVFKTTSFPNVSTWN 75 Query: 9 SLI 1 +LI Sbjct: 76 ALI 78 >ref|XP_009413568.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25060, mitochondrial [Musa acuminata subsp. malaccensis] Length = 679 Score = 69.7 bits (169), Expect = 7e-10 Identities = 32/62 (51%), Positives = 45/62 (72%) Frame = -2 Query: 186 SIGDPKTLAKIHALLILTGSLSHPQYPGHLIAAYSRFNNISAAHSVFVTIPQPTISAYNS 7 S D + L +IHAL+++TGSL +P GHLI+AY+R +++AAHSVF T P IS +N+ Sbjct: 16 SCSDAQALVQIHALMLVTGSLYYPHSSGHLISAYARIGDVAAAHSVFRTASNPNISTWNA 75 Query: 6 LI 1 LI Sbjct: 76 LI 77