BLASTX nr result
ID: Anemarrhena21_contig00044619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00044619 (202 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010924477.1| PREDICTED: probable inositol oxygenase [Elae... 65 2e-08 >ref|XP_010924477.1| PREDICTED: probable inositol oxygenase [Elaeis guineensis] Length = 310 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/51 (66%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -2 Query: 150 MTVIVPEPDLDENNIIQGEENLAEEIE-DGSLNLDGGFSVPDSNAFGHSFR 1 M VIVPEP L+ +N Q EN +E E DG L+LDGGF VPDSNAFGHSFR Sbjct: 1 MAVIVPEPVLEGSNNSQDVENYVKEQENDGDLSLDGGFVVPDSNAFGHSFR 51