BLASTX nr result
ID: Anemarrhena21_contig00044550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00044550 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008349731.1| PREDICTED: LOW QUALITY PROTEIN: licodione sy... 56 8e-06 gb|AGV40503.1| hypothetical protein [Phaseolus vulgaris] 56 8e-06 >ref|XP_008349731.1| PREDICTED: LOW QUALITY PROTEIN: licodione synthase-like [Malus domestica] Length = 624 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 3/63 (4%) Frame = +2 Query: 38 NKLKALALLHIVP---RLSRGISLRRIFWHFPPPGWHKVNVDGAARSSPSMASCGGVFRN 208 N ++ L +LH + R ++ + + WH PP W KVN DGAAR SP +A+ GG+FR+ Sbjct: 3 NYVEXLYILHSIGVRGRPTKAPKIIEVLWHPPPQSWIKVNTDGAARGSPGVAAFGGIFRD 62 Query: 209 YRG 217 + G Sbjct: 63 FIG 65 >gb|AGV40503.1| hypothetical protein [Phaseolus vulgaris] Length = 234 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = +2 Query: 107 IFWHFPPPGWHKVNVDGAARSSPSMASCGGVFRNYRG 217 I W FP PGW K+N DGAAR P +A+CGG+FR G Sbjct: 67 IRWEFPSPGWVKINTDGAARGYPGLATCGGIFRGSMG 103