BLASTX nr result
ID: Anemarrhena21_contig00044537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00044537 (276 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008787393.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 ref|XP_010935759.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 >ref|XP_008787393.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06140, mitochondrial [Phoenix dactylifera] Length = 664 Score = 70.1 bits (170), Expect = 5e-10 Identities = 40/74 (54%), Positives = 49/74 (66%), Gaps = 3/74 (4%) Frame = -1 Query: 216 SIPAIIQTPASKNLNSFVPFCNSLHLVHQFHAQTHLHGLQLSPFFGSKRTTSYFDSYSFS 37 +IPAI TP SK+LNS P C+SL L+ Q HA+ LHGL LS FFGS+ +YF + + S Sbjct: 7 TIPAI-PTPTSKHLNSLFPLCHSLRLLRQLHARILLHGLHLSAFFGSRLAHAYFAAGAGS 65 Query: 36 ---ARRVFDQIPTK 4 ARR FDQI K Sbjct: 66 PQDARRAFDQILAK 79 >ref|XP_010935759.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06140, mitochondrial [Elaeis guineensis] Length = 678 Score = 68.2 bits (165), Expect = 2e-09 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = -1 Query: 216 SIPAIIQTPASKNLNSFVPFCNSLHLVHQFHAQTHLHGLQLSPFFGSKRTTSYFDSYS-F 40 +IPAI TP SK+LNS P C+SL L+ Q H + LHGL LS FFGS+ +YF + S Sbjct: 7 TIPAIA-TPTSKHLNSLFPLCHSLRLLRQVHTRILLHGLHLSVFFGSRLAHAYFATGSPQ 65 Query: 39 SARRVFDQIPTK 4 ARR FDQI K Sbjct: 66 DARRAFDQILAK 77