BLASTX nr result
ID: Anemarrhena21_contig00044382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00044382 (270 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010935506.1| PREDICTED: pentatricopeptide repeat-containi... 80 7e-13 ref|XP_010940322.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_008803620.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_008777843.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_010906103.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_009401166.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_007046988.1| Tetratricopeptide repeat (TPR)-like superfam... 63 9e-08 ref|XP_012436918.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006409140.1| hypothetical protein EUTSA_v10023199mg, part... 62 1e-07 ref|XP_009407512.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_009112497.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 emb|CDY67618.1| BnaA09g52830D [Brassica napus] 60 6e-07 gb|KDO79503.1| hypothetical protein CISIN_1g015673mg [Citrus sin... 59 1e-06 ref|XP_006425713.1| hypothetical protein CICLE_v10025762mg [Citr... 59 1e-06 gb|AEI98618.1| hypothetical protein 111O18.5 [Coffea canephora] 59 1e-06 ref|XP_009356679.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_010029819.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 emb|CDP02821.1| unnamed protein product [Coffea canephora] 58 2e-06 gb|KCW56790.1| hypothetical protein EUGRSUZ_I02459 [Eucalyptus g... 58 2e-06 emb|CDY66741.1| BnaCnng52150D [Brassica napus] 58 3e-06 >ref|XP_010935506.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Elaeis guineensis] Length = 386 Score = 79.7 bits (195), Expect = 7e-13 Identities = 38/64 (59%), Positives = 50/64 (78%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 A + G HA +P+IRRLAR++ FS IE+LLEPLK P EP L++++TSYAA+GML+H Sbjct: 36 APIFLGHHAFDPAIRRLARARRFSDIEALLEPLKKDPRASGEPFLAAVVTSYAAAGMLEH 95 Query: 13 ALRT 2 ALRT Sbjct: 96 ALRT 99 >ref|XP_010940322.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Elaeis guineensis] Length = 388 Score = 79.0 bits (193), Expect = 1e-12 Identities = 41/64 (64%), Positives = 49/64 (76%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 A L SG HA +P+IRRLAR++ FS IE+LLE LK P E L+S+ITSYAA+GMLDH Sbjct: 38 APLFSGYHAFDPAIRRLARARRFSDIEALLEVLKKDPRASNELFLASVITSYAAAGMLDH 97 Query: 13 ALRT 2 ALRT Sbjct: 98 ALRT 101 >ref|XP_008803620.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Phoenix dactylifera] Length = 386 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/64 (57%), Positives = 50/64 (78%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 A L S HA +P+I RLAR++ FS IE+LLEPLK P +EP L++++TSY+A+GML+H Sbjct: 36 APLLSSCHAFDPAIHRLARARRFSDIEALLEPLKRDPRASSEPFLAAVVTSYSAAGMLEH 95 Query: 13 ALRT 2 ALRT Sbjct: 96 ALRT 99 >ref|XP_008777843.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Phoenix dactylifera] Length = 419 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/64 (48%), Positives = 46/64 (71%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 AS S A++ ++RRLAR++ F+ +E+LLE K PH EP L+++I SY A+GM+DH Sbjct: 70 ASPVSARFAVDLAVRRLARARRFADVEALLESRKSAPHAANEPFLATVILSYGAAGMIDH 129 Query: 13 ALRT 2 A+RT Sbjct: 130 AIRT 133 >ref|XP_010906103.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Elaeis guineensis] gi|743870671|ref|XP_010906104.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Elaeis guineensis] gi|743870675|ref|XP_010906105.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Elaeis guineensis] Length = 413 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/64 (48%), Positives = 45/64 (70%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 AS S A++ ++RRLAR++ F+ +E+LLE K PH EP L+++I SY A+GM+DH Sbjct: 64 ASPVSARFAVDLAVRRLARARRFADVETLLESRKSGPHAANEPFLATVILSYGAAGMIDH 123 Query: 13 ALRT 2 A RT Sbjct: 124 ATRT 127 >ref|XP_009401166.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 382 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -3 Query: 163 EPSIRRLARSQNFSQIESLLEPLKYP-PHPLTEPHLSSIITSYAASGMLDHALRT 2 +P IRRLAR + FS IESLLEPLK + +EP L+S++ SYA++GMLD ALRT Sbjct: 40 DPEIRRLARLRRFSDIESLLEPLKKDRENASSEPFLASVVASYASAGMLDQALRT 94 >ref|XP_007046988.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508699249|gb|EOX91145.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 411 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/64 (50%), Positives = 45/64 (70%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 +S SS +A + ++RRLA+S+ FS IESL+E K P EP LS++I SY +GMLDH Sbjct: 59 SSPSSSRYAQDLTVRRLAKSRRFSDIESLIESHKTDPKITQEPFLSTLIRSYGIAGMLDH 118 Query: 13 ALRT 2 A++T Sbjct: 119 AIKT 122 >ref|XP_012436918.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Gossypium raimondii] gi|763781351|gb|KJB48422.1| hypothetical protein B456_008G068700 [Gossypium raimondii] Length = 408 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/64 (50%), Positives = 45/64 (70%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 +S SS +A + ++RRLA+S+ FS IESL+E K P EP LS++I SY +GMLDH Sbjct: 59 SSPSSSRYAQDLTVRRLAKSRRFSDIESLIESHKTDPKISQEPFLSTLIRSYGIAGMLDH 118 Query: 13 ALRT 2 A++T Sbjct: 119 AIKT 122 >ref|XP_006409140.1| hypothetical protein EUTSA_v10023199mg, partial [Eutrema salsugineum] gi|557110302|gb|ESQ50593.1| hypothetical protein EUTSA_v10023199mg, partial [Eutrema salsugineum] Length = 411 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/60 (51%), Positives = 42/60 (70%) Frame = -3 Query: 181 SGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDHALRT 2 S +A+E ++RRLA+SQ FS IE+L+E K P TEP LS++I SY + M DHAL+T Sbjct: 67 SSRYAMELTVRRLAKSQRFSDIEALIESHKNDPKIKTEPFLSTLIRSYGRASMFDHALKT 126 >ref|XP_009407512.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 407 Score = 62.0 bits (149), Expect = 2e-07 Identities = 32/64 (50%), Positives = 45/64 (70%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 A +S +ALE ++RRLARS+ FS +E+LLE LTE +++++I SY +GMLDH Sbjct: 58 ADSTSARYALELTVRRLARSRRFSDVEALLEYRMSAAAGLTEHYVATVILSYGTAGMLDH 117 Query: 13 ALRT 2 ALRT Sbjct: 118 ALRT 121 >ref|XP_009112497.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18520, mitochondrial [Brassica rapa] Length = 419 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/60 (50%), Positives = 40/60 (66%) Frame = -3 Query: 181 SGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDHALRT 2 S +A+E ++RRLARS FS +E+L+E K P TE LS++I SY + M DHALRT Sbjct: 64 SSRYAMELTVRRLARSHRFSDVEALIESRKKDPQIKTESFLSTLIRSYGRASMFDHALRT 123 >emb|CDY67618.1| BnaA09g52830D [Brassica napus] Length = 419 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/60 (50%), Positives = 40/60 (66%) Frame = -3 Query: 181 SGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDHALRT 2 S +A+E ++RRLARS FS +E+L+E K P TE LS++I SY + M DHALRT Sbjct: 64 SSRYAMELTVRRLARSHRFSDVEALIESRKKDPQIKTESFLSTLIRSYGRASMFDHALRT 123 >gb|KDO79503.1| hypothetical protein CISIN_1g015673mg [Citrus sinensis] Length = 403 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/64 (46%), Positives = 43/64 (67%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 AS S +A + ++RRLA+S+ FS IE+L+E K P EP+L ++I SY +GM DH Sbjct: 56 ASPVSSRYAQDLTVRRLAKSKRFSDIETLIESHKNDPKITQEPYLCNLIRSYGQAGMFDH 115 Query: 13 ALRT 2 A+RT Sbjct: 116 AMRT 119 >ref|XP_006425713.1| hypothetical protein CICLE_v10025762mg [Citrus clementina] gi|568824774|ref|XP_006466769.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Citrus sinensis] gi|557527703|gb|ESR38953.1| hypothetical protein CICLE_v10025762mg [Citrus clementina] Length = 403 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/64 (46%), Positives = 43/64 (67%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 AS S +A + ++RRLA+S+ FS IE+L+E K P EP+L ++I SY +GM DH Sbjct: 56 ASPVSSRYAQDLTVRRLAKSKRFSDIETLIESHKNDPKITQEPYLCNLIRSYGQAGMFDH 115 Query: 13 ALRT 2 A+RT Sbjct: 116 AMRT 119 >gb|AEI98618.1| hypothetical protein 111O18.5 [Coffea canephora] Length = 417 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/60 (51%), Positives = 38/60 (63%) Frame = -3 Query: 181 SGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDHALRT 2 S + E ++RRLA+S FS IES LE K P EP LSS+I SY +GM DHAL+T Sbjct: 75 SSRYTQEYTVRRLAKSHRFSDIESFLESHKNDPKITQEPFLSSLIRSYGLAGMFDHALKT 134 >ref|XP_009356679.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Pyrus x bretschneideri] Length = 405 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/64 (46%), Positives = 42/64 (65%) Frame = -3 Query: 193 ASLSSGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDH 14 +S +S +A + ++RRLA+S F+ IES +E K P EP LS++I SY +GM DH Sbjct: 52 SSPTSSRYAQDLTVRRLAKSHRFADIESFIESHKNDPKITQEPFLSTLIRSYGRAGMFDH 111 Query: 13 ALRT 2 ALRT Sbjct: 112 ALRT 115 >ref|XP_010029819.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Eucalyptus grandis] Length = 434 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/60 (46%), Positives = 41/60 (68%) Frame = -3 Query: 181 SGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDHALRT 2 S +A + +IRRLA+S+ F+ IE+L+E K P EP+L ++I SY +GM DHA+RT Sbjct: 84 SSRYAQDLTIRRLAKSRRFADIEALVESHKAGPQAAQEPYLCTLIRSYGVAGMFDHAMRT 143 >emb|CDP02821.1| unnamed protein product [Coffea canephora] Length = 417 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/60 (50%), Positives = 38/60 (63%) Frame = -3 Query: 181 SGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDHALRT 2 S + E ++RRLA+S FS IE+ LE K P EP LSS+I SY +GM DHAL+T Sbjct: 75 SSRYTQEYTVRRLAKSHRFSDIENFLESHKNDPKITQEPFLSSLIRSYGLAGMFDHALKT 134 >gb|KCW56790.1| hypothetical protein EUGRSUZ_I02459 [Eucalyptus grandis] Length = 464 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/60 (46%), Positives = 41/60 (68%) Frame = -3 Query: 181 SGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDHALRT 2 S +A + +IRRLA+S+ F+ IE+L+E K P EP+L ++I SY +GM DHA+RT Sbjct: 84 SSRYAQDLTIRRLAKSRRFADIEALVESHKAGPQAAQEPYLCTLIRSYGVAGMFDHAMRT 143 >emb|CDY66741.1| BnaCnng52150D [Brassica napus] Length = 419 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/60 (46%), Positives = 39/60 (65%) Frame = -3 Query: 181 SGPHALEPSIRRLARSQNFSQIESLLEPLKYPPHPLTEPHLSSIITSYAASGMLDHALRT 2 S +A+E ++RRL RS FS +E+L+E K P TE LS++I SY + M DHA+RT Sbjct: 64 SSRYAMELTVRRLVRSHRFSDVEALIESRKKDPQIKTESFLSTLIRSYGRASMFDHAMRT 123