BLASTX nr result
ID: Anemarrhena21_contig00044282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00044282 (613 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21837.3| unnamed protein product [Vitis vinifera] 64 7e-08 ref|XP_007132667.1| hypothetical protein PHAVU_011G114500g, part... 61 5e-07 gb|KHN35259.1| hypothetical protein glysoja_042329 [Glycine soja] 58 4e-06 >emb|CBI21837.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 63.5 bits (153), Expect = 7e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 512 MAEFEKQLKKTAKELKHLLKKGMKVVADSCKKGWHKVR 399 MAEFEKQLK+ A+ELK KKG+K+V DSCKKGW+KVR Sbjct: 330 MAEFEKQLKERARELKTFFKKGVKIVGDSCKKGWYKVR 367 >ref|XP_007132667.1| hypothetical protein PHAVU_011G114500g, partial [Phaseolus vulgaris] gi|561005667|gb|ESW04661.1| hypothetical protein PHAVU_011G114500g, partial [Phaseolus vulgaris] Length = 70 Score = 60.8 bits (146), Expect = 5e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 515 IMAEFEKQLKKTAKELKHLLKKGMKVVADSCKKGWHKVR 399 +MA FE+Q+K AKELK LLKKG+K+V DSCKKGW+KV+ Sbjct: 28 VMAGFEQQVKDRAKELKVLLKKGVKIVGDSCKKGWNKVK 66 >gb|KHN35259.1| hypothetical protein glysoja_042329 [Glycine soja] Length = 232 Score = 57.8 bits (138), Expect = 4e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -3 Query: 515 IMAEFEKQLKKTAKELKHLLKKGMKVVADSCKKGWHKVR 399 +M FE+++K AKELK LLKKG+K+V DSCKKGW+KV+ Sbjct: 190 LMGGFEQKMKDRAKELKVLLKKGVKIVGDSCKKGWNKVK 228