BLASTX nr result
ID: Anemarrhena21_contig00044222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00044222 (456 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63166.1| retrotransposon del1-46, related [Asparagus offic... 70 6e-10 >gb|ABD63166.1| retrotransposon del1-46, related [Asparagus officinalis] Length = 136 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +1 Query: 298 MRAPEFHGGADPLAADKWKGDIWKLLKLLRLDTVKCQRLASFCLKGEADKWY 453 MRAPEF G ADPL A KWK D+ +L +L +D+V+ QRLAS+ LKG+A +WY Sbjct: 1 MRAPEFQGSADPLVAHKWKEDVSNILDILSVDSVQKQRLASYSLKGDARRWY 52