BLASTX nr result
ID: Anemarrhena21_contig00044095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00044095 (391 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008790885.1| PREDICTED: 5'-adenylylsulfate reductase-like... 56 8e-06 >ref|XP_008790885.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Phoenix dactylifera] gi|672134475|ref|XP_008790886.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Phoenix dactylifera] Length = 315 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +3 Query: 252 PASVNPTSVEKVAGSLEIPQLEETTEQENRPFSWARSPEKLLQEDT 389 PAS+ P +EK +L+E EQEN PFSWARSPEKLLQ+DT Sbjct: 168 PASLYPIHLEKTVDPSNDTELKEGNEQENCPFSWARSPEKLLQQDT 213