BLASTX nr result
ID: Anemarrhena21_contig00043576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00043576 (202 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_032941583.1| hypothetical protein [Citrobacter sp. 30_2] 69 2e-09 ref|WP_026390740.1| hypothetical protein [Acholeplasma axanthum] 60 6e-07 gb|ADI17229.1| hypothetical protein [uncultured alpha proteobact... 60 7e-07 >ref|WP_032941583.1| hypothetical protein [Citrobacter sp. 30_2] Length = 115 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/58 (62%), Positives = 42/58 (72%) Frame = -3 Query: 188 KLRIPTSHSSADRRRVLRSVVERGRAQTVI*GPQVMAKWERM*EGQDSQEVGLEAAIL 15 KLRIP + + D RRVL SVV+R QT GP+VM KWE M EG DSQ+VGLEAAI+ Sbjct: 58 KLRIPKNVITGDTRRVLTSVVKRETTQTASYGPKVMVKWETMWEGTDSQDVGLEAAII 115 >ref|WP_026390740.1| hypothetical protein [Acholeplasma axanthum] Length = 74 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/57 (54%), Positives = 38/57 (66%) Frame = -2 Query: 174 NES*FGRQTAGAKVRGREGKSPDRHLRSPSYG*VGKDVGRPRQPGGWLRSSHPLKKA 4 ++S QT G KV G++G SPDR LRS + V K+V +Q GGWLRSSHPLK A Sbjct: 18 HKSEISSQTVGDKVHGQKGNSPDRQLRSQNSCWVEKEVEMHKQLGGWLRSSHPLKSA 74 >gb|ADI17229.1| hypothetical protein [uncultured alpha proteobacterium HF0070_14E07] Length = 139 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 2 YAFFKGWLLLSQPPGCLGLPTSFPT 76 YAFFKGWLLLSQPPGCLGLPTSFPT Sbjct: 115 YAFFKGWLLLSQPPGCLGLPTSFPT 139