BLASTX nr result
ID: Anemarrhena21_contig00043537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00043537 (555 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009155542.1| photosystem I assembly protein Ycf3 (chlorop... 85 2e-14 ref|XP_008779519.1| PREDICTED: photosystem I assembly protein Yc... 85 2e-14 ref|YP_052750.1| photosystem I assembly protein Ycf3 (chloroplas... 85 2e-14 ref|NP_039384.1| photosystem I assembly protein Ycf3 [Oryza sati... 85 2e-14 prf||1603356AC intron-containing ORF 170 [Oryza sativa] 85 2e-14 ref|YP_005089148.1| ycf3 gene product [Rhynchoryza subulata] gi|... 85 2e-14 ref|YP_005088011.1| ycf3 gene product [Leersia tisserantii] gi|3... 85 2e-14 sp|P0C517.1|YCF3_ORYSI RecName: Full=Photosystem I assembly prot... 85 2e-14 gb|ABC02753.1| Ycf3 protein, partial (chloroplast) [Phyllostachy... 85 2e-14 ref|YP_009034098.1| photosystem I assembly protein Ycf3 (plastid... 85 2e-14 ref|YP_009156877.1| photosystem I assembly protein Ycf3 (plastid... 84 5e-14 gb|AGP50756.1| hypothetical chloroplast RF34 (chloroplast) [Hord... 84 5e-14 gb|AEZ48790.1| photosystem I assembly protein Ycf3, partial [Spa... 84 5e-14 ref|YP_874654.1| photosystem I assembly protein ycf3 (chloroplas... 84 5e-14 ref|YP_009142051.1| Ycf3 (chloroplast) [Fagopyrum tataricum] gi|... 83 7e-14 ref|YP_009073015.1| hypothetical chloroplast RF34 [Elytrophorus ... 83 7e-14 gb|AAB30283.2| IRF170 (chloroplast) [Zea mays subsp. mays] 83 7e-14 sp|P27324.2|YCF3_MAIZE RecName: Full=Photosystem I assembly prot... 83 7e-14 ref|YP_009155213.1| photosystem I assembly protein Ycf3 (plastid... 83 7e-14 ref|YP_740118.1| photosystem I assembly protein ycf3 [Daucus car... 83 7e-14 >ref|YP_009155542.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza barthii] gi|884997859|ref|YP_009155624.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza glumipatula] gi|884997943|ref|YP_009155707.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza longistaminata] gi|884998027|ref|YP_009155790.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza officinalis] gi|761231225|gb|AJP33634.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza barthii] gi|761231308|gb|AJP33716.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza barthii] gi|761231391|gb|AJP33798.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza barthii] gi|761231474|gb|AJP33880.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza barthii] gi|761231558|gb|AJP33963.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza glaberrima] gi|761231640|gb|AJP34044.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza glaberrima] gi|761231724|gb|AJP34127.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza glumipatula] gi|761231808|gb|AJP34210.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza longistaminata] gi|761231892|gb|AJP34293.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza longistaminata] gi|761231976|gb|AJP34376.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza officinalis] Length = 170 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRD 41 >ref|XP_008779519.1| PREDICTED: photosystem I assembly protein Ycf3 [Phoenix dactylifera] Length = 75 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRD 41 >ref|YP_052750.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza nivara] gi|68053141|sp|Q6ENH3.1|YCF3_ORYNI RecName: Full=Photosystem I assembly protein Ycf3 gi|49614996|dbj|BAD26779.1| photosystem I assembly protein Ycf3 (chloroplast) [Oryza nivara] Length = 170 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRD 41 >ref|NP_039384.1| photosystem I assembly protein Ycf3 [Oryza sativa Japonica Group] gi|669081|emb|CAA33997.1| unnamed protein product (chloroplast) [Oryza sativa Japonica Group] Length = 169 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRD 41 >prf||1603356AC intron-containing ORF 170 [Oryza sativa] Length = 170 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRD 41 >ref|YP_005089148.1| ycf3 gene product [Rhynchoryza subulata] gi|669136046|ref|YP_009049270.1| hypothetical chloroplast RF34 (chloroplast) [Oryza australiensis] gi|346228473|gb|AEO21345.1| hypothetical chloroplast RF34 [Rhynchoryza subulata] gi|353685054|gb|AER12819.1| hypothetical chloroplast RF34 (chloroplast) [Oryza sativa Indica Group] gi|353685142|gb|AER12906.1| hypothetical chloroplast RF34 (chloroplast) [Oryza sativa Indica Group] gi|555945989|gb|AGZ19215.1| hypothetical chloroplast RF34 (chloroplast) [Oryza rufipogon] gi|662117290|gb|AIE44576.1| hypothetical chloroplast RF34 (chloroplast) [Oryza australiensis] Length = 172 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRD 41 >ref|YP_005088011.1| ycf3 gene product [Leersia tisserantii] gi|346228305|gb|AEO21179.1| hypothetical chloroplast RF34 [Leersia tisserantii] Length = 172 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRD 41 >sp|P0C517.1|YCF3_ORYSI RecName: Full=Photosystem I assembly protein Ycf3 gi|148887458|sp|P12203.3|YCF3_ORYSJ RecName: Full=Photosystem I assembly protein Ycf3 gi|148897905|sp|P0C516.1|YCF3_ORYSA RecName: Full=Photosystem I assembly protein Ycf3 Length = 170 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRD 41 >gb|ABC02753.1| Ycf3 protein, partial (chloroplast) [Phyllostachys edulis] Length = 41 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRD 41 >ref|YP_009034098.1| photosystem I assembly protein Ycf3 (plastid) [Oryza glaberrima] gi|56784286|dbj|BAD81968.1| Chloroplast photosystem I assembly protein Ycf3 [Oryza sativa Japonica Group] gi|634743461|gb|AHZ60712.1| photosystem I assembly protein Ycf3 [Oryza glaberrima] Length = 169 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRD 41 >ref|YP_009156877.1| photosystem I assembly protein Ycf3 (plastid) [Hordeum jubatum] gi|768805005|gb|AJV89784.1| photosystem I assembly protein Ycf3 (plastid) [Hordeum jubatum] Length = 170 Score = 83.6 bits (205), Expect = 5e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSR+NGNFIDKTFSIIANILLRIIPTTSGEK+AFTYYRD Sbjct: 1 MPRSRVNGNFIDKTFSIIANILLRIIPTTSGEKKAFTYYRD 41 >gb|AGP50756.1| hypothetical chloroplast RF34 (chloroplast) [Hordeum vulgare subsp. vulgare] gi|521301030|gb|AGP50832.1| hypothetical chloroplast RF34 (chloroplast) [Hordeum vulgare subsp. spontaneum] gi|521301111|gb|AGP50912.1| hypothetical chloroplast RF34 (chloroplast) [Hordeum vulgare subsp. spontaneum] Length = 172 Score = 83.6 bits (205), Expect = 5e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSR+NGNFIDKTFSIIANILLRIIPTTSGEK+AFTYYRD Sbjct: 1 MPRSRVNGNFIDKTFSIIANILLRIIPTTSGEKKAFTYYRD 41 >gb|AEZ48790.1| photosystem I assembly protein Ycf3, partial [Sparganium eurycarpum] Length = 168 Score = 83.6 bits (205), Expect = 5e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILLRIIPTTSGEK+AFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKKAFTYYRD 41 >ref|YP_874654.1| photosystem I assembly protein ycf3 (chloroplast) [Hordeum vulgare subsp. vulgare] gi|171704520|sp|A1E9J2.1|YCF3_HORVU RecName: Full=Photosystem I assembly protein Ycf3 gi|118201043|gb|ABK79414.1| photosystem I assembly protein ycf3 (chloroplast) [Hordeum vulgare subsp. vulgare] Length = 170 Score = 83.6 bits (205), Expect = 5e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSR+NGNFIDKTFSIIANILLRIIPTTSGEK+AFTYYRD Sbjct: 1 MPRSRVNGNFIDKTFSIIANILLRIIPTTSGEKKAFTYYRD 41 >ref|YP_009142051.1| Ycf3 (chloroplast) [Fagopyrum tataricum] gi|723430240|gb|AIX89744.1| Ycf3 (chloroplast) [Fagopyrum tataricum] Length = 169 Score = 83.2 bits (204), Expect = 7e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFS++ANILLRIIPTTSGEK+AFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSVVANILLRIIPTTSGEKKAFTYYRD 41 >ref|YP_009073015.1| hypothetical chloroplast RF34 [Elytrophorus spicatus] gi|686986023|gb|AIQ79541.1| hypothetical chloroplast RF34 (plastid) [Elytrophorus spicatus] Length = 170 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILL+IIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKRAFTYYRD 41 >gb|AAB30283.2| IRF170 (chloroplast) [Zea mays subsp. mays] Length = 170 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILL+IIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKRAFTYYRD 41 >sp|P27324.2|YCF3_MAIZE RecName: Full=Photosystem I assembly protein Ycf3; AltName: Full=IRF170 gi|93140420|sp|P0C160.1|YCF3_SACHY RecName: Full=Photosystem I assembly protein Ycf3 Length = 170 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSI+ANILL+IIPTTSGEKRAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKRAFTYYRD 41 >ref|YP_009155213.1| photosystem I assembly protein Ycf3 (plastid) [Pastinaca pimpinellifolia] gi|884997506|ref|YP_009155295.1| photosystem I assembly protein Ycf3 (plastid) [Seseli montanum] gi|156597915|gb|ABU85225.1| photosystem I assembly protein ycf3 [Anethum graveolens] gi|302025022|gb|ADK89864.1| hypothetical chloroplast RF34 (chloroplast) [Crithmum maritimum] gi|302025111|gb|ADK89952.1| hypothetical chloroplast RF34 (chloroplast) [Petroselinum crispum] gi|700746242|gb|AIU99021.1| photosystem I assembly protein Ycf3 (plastid) [Pastinaca pimpinellifolia] gi|700746345|gb|AIU99103.1| photosystem I assembly protein Ycf3 (plastid) [Seseli montanum] Length = 168 Score = 83.2 bits (204), Expect = 7e-14 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEK AFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_740118.1| photosystem I assembly protein ycf3 [Daucus carota] gi|323149083|ref|YP_004222647.1| hypothetical chloroplast RF34 (chloroplast) [Anthriscus cerefolium] gi|122227486|sp|Q0G9W1.1|YCF3_DAUCA RecName: Full=Photosystem I assembly protein Ycf3 gi|113200909|gb|ABI32425.1| photosystem I assembly protein ycf3 [Daucus carota] gi|289645576|gb|ADD13639.1| hypothetical chloroplast RF34 (chloroplast) [Anthriscus cerefolium] gi|302024936|gb|ADK89779.1| hypothetical chloroplast RF34 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] Length = 168 Score = 83.2 bits (204), Expect = 7e-14 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 125 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKRAFTYYRD 3 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEK AFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIIANILLRIIPTTSGEKEAFTYYRD 41