BLASTX nr result
ID: Anemarrhena21_contig00043325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00043325 (338 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010272864.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 emb|CBI19066.3| unnamed protein product [Vitis vinifera] 56 8e-06 ref|XP_002284396.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 ref|XP_007224379.1| hypothetical protein PRUPE_ppa021566mg [Prun... 56 8e-06 >ref|XP_010272864.1| PREDICTED: pentatricopeptide repeat-containing protein At4g08210 [Nelumbo nucifera] Length = 711 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 338 TMSNIYASLGMWEDSEKLRQLMRRVGKKESGRSWIEV 228 T+SNIYASLGMW DS KLR+L+R G KE+G SWI V Sbjct: 673 TLSNIYASLGMWTDSTKLRELIRETGMKEAGLSWIVV 709 >emb|CBI19066.3| unnamed protein product [Vitis vinifera] Length = 521 Score = 56.2 bits (134), Expect = 8e-06 Identities = 20/37 (54%), Positives = 34/37 (91%) Frame = -1 Query: 338 TMSNIYASLGMWEDSEKLRQLMRRVGKKESGRSWIEV 228 T+SN+YA+L MW+DS K+R+++++VG KE+G+SWI++ Sbjct: 483 TLSNVYATLEMWDDSRKMREVIKKVGMKEAGKSWIQI 519 >ref|XP_002284396.1| PREDICTED: pentatricopeptide repeat-containing protein At4g08210 [Vitis vinifera] gi|731428175|ref|XP_010664247.1| PREDICTED: pentatricopeptide repeat-containing protein At4g08210 [Vitis vinifera] Length = 690 Score = 56.2 bits (134), Expect = 8e-06 Identities = 20/37 (54%), Positives = 34/37 (91%) Frame = -1 Query: 338 TMSNIYASLGMWEDSEKLRQLMRRVGKKESGRSWIEV 228 T+SN+YA+L MW+DS K+R+++++VG KE+G+SWI++ Sbjct: 652 TLSNVYATLEMWDDSRKMREVIKKVGMKEAGKSWIQI 688 >ref|XP_007224379.1| hypothetical protein PRUPE_ppa021566mg [Prunus persica] gi|462421315|gb|EMJ25578.1| hypothetical protein PRUPE_ppa021566mg [Prunus persica] Length = 691 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 338 TMSNIYASLGMWEDSEKLRQLMRRVGKKESGRSWIEV 228 T+SN+YA LGMW D K+R +++VG KE+GRSWIEV Sbjct: 655 TLSNVYAELGMWNDLSKVRAAVKKVGAKEAGRSWIEV 691