BLASTX nr result
ID: Anemarrhena21_contig00043258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00043258 (265 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101065.1| PREDICTED: uncharacterized protein LOC105179... 105 4e-32 ref|XP_011081478.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 103 2e-31 ref|XP_010667645.1| PREDICTED: uncharacterized protein LOC104884... 102 4e-31 ref|XP_010694721.1| PREDICTED: uncharacterized protein LOC104907... 102 4e-31 gb|KDP35540.1| hypothetical protein JCGZ_08978 [Jatropha curcas] 101 2e-30 ref|XP_006480387.1| PREDICTED: uncharacterized protein LOC102611... 102 2e-30 ref|XP_011100524.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 102 2e-30 ref|XP_010693276.1| PREDICTED: uncharacterized protein LOC104906... 100 3e-30 ref|XP_008348736.1| PREDICTED: uncharacterized protein LOC103411... 100 1e-29 ref|XP_010246157.1| PREDICTED: uncharacterized protein LOC104589... 97 2e-29 ref|XP_008383101.1| PREDICTED: uncharacterized protein LOC103445... 100 3e-29 ref|XP_010670252.1| PREDICTED: uncharacterized protein LOC104887... 102 4e-29 ref|XP_008347142.1| PREDICTED: uncharacterized protein LOC103410... 100 5e-29 ref|XP_011078528.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 98 5e-29 ref|XP_010696494.1| PREDICTED: uncharacterized protein LOC104909... 99 8e-29 ref|XP_008230267.1| PREDICTED: uncharacterized protein LOC103329... 93 8e-29 ref|XP_012482817.1| PREDICTED: uncharacterized protein LOC105797... 96 9e-29 ref|XP_010246129.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 97 1e-28 ref|XP_008348519.1| PREDICTED: uncharacterized protein LOC103411... 100 1e-28 ref|XP_008344611.1| PREDICTED: uncharacterized protein LOC103407... 99 1e-28 >ref|XP_011101065.1| PREDICTED: uncharacterized protein LOC105179165 [Sesamum indicum] Length = 1460 Score = 105 bits (263), Expect(2) = 4e-32 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQTNGQAEVSNREIKSILEKTVNPNRKDWS+R DDALWAYRTAYKTPI +S Sbjct: 1250 TAYHPQTNGQAEVSNREIKSILEKTVNPNRKDWSVRLDDALWAYRTAYKTPIGMS 1304 Score = 58.9 bits (141), Expect(2) = 4e-32 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLVFGKPCHLPVELEHRA+WA Sbjct: 1303 MSPYRLVFGKPCHLPVELEHRAFWA 1327 >ref|XP_011081478.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164525 [Sesamum indicum] Length = 1610 Score = 103 bits (257), Expect(2) = 2e-31 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQTNGQAEVSN EIKSILEKTVNPNRKDWS+R DDALWAYRTAYKTPI +S Sbjct: 1336 TAYHPQTNGQAEVSNSEIKSILEKTVNPNRKDWSVRLDDALWAYRTAYKTPIGMS 1390 Score = 58.9 bits (141), Expect(2) = 2e-31 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLVFGKPCHLPVELEHRA+WA Sbjct: 1389 MSPYRLVFGKPCHLPVELEHRAFWA 1413 >ref|XP_010667645.1| PREDICTED: uncharacterized protein LOC104884660 [Beta vulgaris subsp. vulgaris] Length = 1861 Score = 102 bits (253), Expect(2) = 4e-31 Identities = 46/55 (83%), Positives = 53/55 (96%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQTNGQAEVSNREIKSILEKTVNP+RKDWS+R +DALWAYRTAYKTPI +S Sbjct: 1651 TAYHPQTNGQAEVSNREIKSILEKTVNPSRKDWSLRLEDALWAYRTAYKTPIGMS 1705 Score = 59.3 bits (142), Expect(2) = 4e-31 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLVFGKPCHLPVELEH+AYWA Sbjct: 1704 MSPYRLVFGKPCHLPVELEHKAYWA 1728 >ref|XP_010694721.1| PREDICTED: uncharacterized protein LOC104907484 [Beta vulgaris subsp. vulgaris] Length = 1822 Score = 102 bits (253), Expect(2) = 4e-31 Identities = 46/55 (83%), Positives = 53/55 (96%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQTNGQAEVSNREIKSILEKTVNP+RKDWS+R +DALWAYRTAYKTPI +S Sbjct: 1612 TAYHPQTNGQAEVSNREIKSILEKTVNPSRKDWSLRLEDALWAYRTAYKTPIGMS 1666 Score = 59.3 bits (142), Expect(2) = 4e-31 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLVFGKPCHLPVELEH+AYWA Sbjct: 1665 MSPYRLVFGKPCHLPVELEHKAYWA 1689 >gb|KDP35540.1| hypothetical protein JCGZ_08978 [Jatropha curcas] Length = 227 Score = 101 bits (252), Expect(2) = 2e-30 Identities = 45/55 (81%), Positives = 53/55 (96%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQT+GQAEVSNRE+KSILEKTV+PNRKDWS+R DDALWAYRTAYKTPI +S Sbjct: 16 TAYHPQTSGQAEVSNREVKSILEKTVSPNRKDWSVRLDDALWAYRTAYKTPIGMS 70 Score = 57.8 bits (138), Expect(2) = 2e-30 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLV+GKPCHLPVELEHRA+WA Sbjct: 69 MSPYRLVYGKPCHLPVELEHRAFWA 93 >ref|XP_006480387.1| PREDICTED: uncharacterized protein LOC102611294 [Citrus sinensis] Length = 1430 Score = 102 bits (255), Expect(2) = 2e-30 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +S+HPQT+GQ EVSNRE+KSILEKTVNPNRKDWS+R DDALWAYRTAYKTPI +S Sbjct: 1239 TSYHPQTSGQVEVSNREVKSILEKTVNPNRKDWSLRLDDALWAYRTAYKTPIGMS 1293 Score = 56.2 bits (134), Expect(2) = 2e-30 Identities = 22/25 (88%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLV+GKPCHLPVELEH+A+WA Sbjct: 1292 MSPYRLVYGKPCHLPVELEHKAWWA 1316 >ref|XP_011100524.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105178691 [Sesamum indicum] Length = 1278 Score = 102 bits (255), Expect(2) = 2e-30 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQTNGQAEVSNR+IKSILEKTVNPNRKDWS R DDALWAYRTAYKTPI +S Sbjct: 989 TAYHPQTNGQAEVSNRKIKSILEKTVNPNRKDWSTRLDDALWAYRTAYKTPIGMS 1043 Score = 56.2 bits (134), Expect(2) = 2e-30 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLV+GK CHLPVELEHRAYWA Sbjct: 1042 MSPYRLVYGKSCHLPVELEHRAYWA 1066 >ref|XP_010693276.1| PREDICTED: uncharacterized protein LOC104906241 [Beta vulgaris subsp. vulgaris] Length = 1777 Score = 100 bits (250), Expect(2) = 3e-30 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQTNG AEVSNREIKSILEKTVNPNRKDWS+R +DALWAYRTAYKTPI +S Sbjct: 1566 TAYHPQTNGLAEVSNREIKSILEKTVNPNRKDWSLRLNDALWAYRTAYKTPIGMS 1620 Score = 57.8 bits (138), Expect(2) = 3e-30 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLVFGKPCHLPVELEH+A+WA Sbjct: 1619 MSPYRLVFGKPCHLPVELEHKAFWA 1643 >ref|XP_008348736.1| PREDICTED: uncharacterized protein LOC103411901 [Malus domestica] Length = 346 Score = 100 bits (250), Expect(2) = 1e-29 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -1 Query: 247 FHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +HPQTNGQAEVSNREIK ILEKTV PNRKDWS+R DDALWAYRTAYKTPI +S Sbjct: 257 YHPQTNGQAEVSNREIKQILEKTVGPNRKDWSLRLDDALWAYRTAYKTPIGMS 309 Score = 55.8 bits (133), Expect(2) = 1e-29 Identities = 22/25 (88%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSP+RLV+GKPCHLPVELEHRA+WA Sbjct: 308 MSPFRLVYGKPCHLPVELEHRAHWA 332 >ref|XP_010246157.1| PREDICTED: uncharacterized protein LOC104589505 [Nelumbo nucifera] Length = 1160 Score = 97.4 bits (241), Expect(2) = 2e-29 Identities = 44/55 (80%), Positives = 51/55 (92%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQT+G+AEVSNREIK ILEK VNPNRKDWS+R DDALWAYRTAYKTPI +S Sbjct: 659 TAYHPQTSGKAEVSNREIKFILEKMVNPNRKDWSLRLDDALWAYRTAYKTPIGMS 713 Score = 58.2 bits (139), Expect(2) = 2e-29 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPY L+FGKPCHLPVELEHRAYWA Sbjct: 712 MSPYHLIFGKPCHLPVELEHRAYWA 736 >ref|XP_008383101.1| PREDICTED: uncharacterized protein LOC103445525 [Malus domestica] Length = 198 Score = 100 bits (250), Expect(2) = 3e-29 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -1 Query: 247 FHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +HPQTNGQAEVSNREIK ILEKTV PNRKDWS+R DDALWAYRTAYKTPI +S Sbjct: 9 YHPQTNGQAEVSNREIKQILEKTVGPNRKDWSLRLDDALWAYRTAYKTPIGMS 61 Score = 54.3 bits (129), Expect(2) = 3e-29 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSP+RLV+GKPCH+PVELEHRA WA Sbjct: 60 MSPFRLVYGKPCHJPVELEHRAXWA 84 >ref|XP_010670252.1| PREDICTED: uncharacterized protein LOC104887336 [Beta vulgaris subsp. vulgaris] gi|731328978|ref|XP_010675341.1| PREDICTED: uncharacterized protein LOC104891357 [Beta vulgaris subsp. vulgaris] Length = 1736 Score = 102 bits (253), Expect(2) = 4e-29 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQTNGQAEVSNREIKSILEK VNPNRKDWS+R DDALWAYRTAYKTP+ +S Sbjct: 1529 TAYHPQTNGQAEVSNREIKSILEKMVNPNRKDWSLRLDDALWAYRTAYKTPLRMS 1583 Score = 52.8 bits (125), Expect(2) = 4e-29 Identities = 20/25 (80%), Positives = 24/25 (96%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLV+GK CHLPVE+EH++YWA Sbjct: 1582 MSPYRLVYGKGCHLPVEIEHKSYWA 1606 >ref|XP_008347142.1| PREDICTED: uncharacterized protein LOC103410170 [Malus domestica] Length = 1838 Score = 100 bits (250), Expect(2) = 5e-29 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -1 Query: 247 FHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +HPQTNGQAEVSNREIK ILEKTV PNRKDWS+R DDALWAYRTAYKTPI +S Sbjct: 1628 YHPQTNGQAEVSNREIKQILEKTVGPNRKDWSLRLDDALWAYRTAYKTPIGMS 1680 Score = 53.5 bits (127), Expect(2) = 5e-29 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSP+RLV+GKPCHLPVELEH A+WA Sbjct: 1679 MSPFRLVYGKPCHLPVELEHXAHWA 1703 >ref|XP_011078528.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105162232 [Sesamum indicum] Length = 1479 Score = 98.2 bits (243), Expect(2) = 5e-29 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQTNGQAEVSNREIKSILEKTVNPNRKDWS R DA WAY TAYKTPI +S Sbjct: 1269 TAYHPQTNGQAEVSNREIKSILEKTVNPNRKDWSTRLXDAFWAYHTAYKTPIGMS 1323 Score = 56.2 bits (134), Expect(2) = 5e-29 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLV+GK CHLPVELEHRAYWA Sbjct: 1322 MSPYRLVYGKSCHLPVELEHRAYWA 1346 >ref|XP_010696494.1| PREDICTED: uncharacterized protein LOC104909016 [Beta vulgaris subsp. vulgaris] Length = 1129 Score = 99.4 bits (246), Expect(2) = 8e-29 Identities = 44/55 (80%), Positives = 51/55 (92%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQTNGQAEVSNREIKSILEK VNPNRKDWS+R DD LWAYRTA+KTP+ +S Sbjct: 922 TAYHPQTNGQAEVSNREIKSILEKMVNPNRKDWSLRLDDTLWAYRTAFKTPLGMS 976 Score = 54.3 bits (129), Expect(2) = 8e-29 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLVFGK CHLPVE+EH++YWA Sbjct: 975 MSPYRLVFGKACHLPVEIEHKSYWA 999 >ref|XP_008230267.1| PREDICTED: uncharacterized protein LOC103329553 [Prunus mume] Length = 695 Score = 93.2 bits (230), Expect(2) = 8e-29 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -1 Query: 247 FHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +HPQT+GQ E+SNREIK ILEKTVN RKDWS+R DDALWAYRTAYKTPI +S Sbjct: 486 YHPQTSGQVEISNREIKHILEKTVNTTRKDWSMRLDDALWAYRTAYKTPIGMS 538 Score = 60.5 bits (145), Expect(2) = 8e-29 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLVFGKPCHLPVELEHRAYWA Sbjct: 537 MSPYRLVFGKPCHLPVELEHRAYWA 561 >ref|XP_012482817.1| PREDICTED: uncharacterized protein LOC105797380 [Gossypium raimondii] Length = 474 Score = 95.9 bits (237), Expect(2) = 9e-29 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQTNGQAEVSNREIKSILEKTV PNRKDWS+ +DALWAYRTAYK PI +S Sbjct: 265 TAYHPQTNGQAEVSNREIKSILEKTVKPNRKDWSLGLNDALWAYRTAYKGPIGMS 319 Score = 57.8 bits (138), Expect(2) = 9e-29 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRLVFGKPCHLPVELEH+A+WA Sbjct: 318 MSPYRLVFGKPCHLPVELEHKAFWA 342 >ref|XP_010246129.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104589483 [Nelumbo nucifera] Length = 1848 Score = 97.1 bits (240), Expect(2) = 1e-28 Identities = 43/55 (78%), Positives = 50/55 (90%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++ PQTNGQAE+SNRE+KSILEK VNP RKDWS+R DDALWAYRTAYKTPI +S Sbjct: 488 TAYRPQTNGQAEISNREVKSILEKMVNPGRKDWSLRLDDALWAYRTAYKTPIGMS 542 Score = 56.2 bits (134), Expect(2) = 1e-28 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPYRL+FGK CHLPVE+EHRAYWA Sbjct: 541 MSPYRLIFGKSCHLPVEIEHRAYWA 565 Score = 92.4 bits (228), Expect(2) = 3e-26 Identities = 41/55 (74%), Positives = 51/55 (92%) Frame = -1 Query: 253 SSFHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +++HPQT+GQA+VSNREIKSILE+ VNP+RKDWS+R DDALWAY+TAYKT I +S Sbjct: 1760 TAYHPQTSGQAKVSNREIKSILERMVNPSRKDWSLRLDDALWAYKTAYKTSIGMS 1814 Score = 52.8 bits (125), Expect(2) = 3e-26 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSPY LVFGKPCHLPV+LEH+A+WA Sbjct: 1813 MSPYWLVFGKPCHLPVKLEHKAHWA 1837 >ref|XP_008348519.1| PREDICTED: uncharacterized protein LOC103411667 [Malus domestica] Length = 317 Score = 100 bits (249), Expect(2) = 1e-28 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -1 Query: 247 FHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +HPQTNGQAEVSNREIK ILEKTV PNRKDWS+R DDALWAYRTAYKTPI +S Sbjct: 104 YHPQTNGQAEVSNREIKXILEKTVGPNRKDWSLRLDDALWAYRTAYKTPIGMS 156 Score = 52.8 bits (125), Expect(2) = 1e-28 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MS +RLV+GKPCHLPVELEHRA+WA Sbjct: 155 MSXFRLVYGKPCHLPVELEHRAHWA 179 >ref|XP_008344611.1| PREDICTED: uncharacterized protein LOC103407455 [Malus domestica] Length = 1449 Score = 98.6 bits (244), Expect(2) = 1e-28 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = -1 Query: 247 FHPQTNGQAEVSNREIKSILEKTVNPNRKDWSIRHDDALWAYRTAYKTPIDVS 89 +HPQTNGQAEVSNREIK ILEKTV P RKDWS+R DDALWAYRTAYKTPI +S Sbjct: 1239 YHPQTNGQAEVSNREIKQILEKTVGPTRKDWSLRLDDALWAYRTAYKTPIGMS 1291 Score = 54.3 bits (129), Expect(2) = 1e-28 Identities = 20/25 (80%), Positives = 25/25 (100%) Frame = -2 Query: 96 MSPYRLVFGKPCHLPVELEHRAYWA 22 MSP+RL++GKPCHLPVELEH+A+WA Sbjct: 1290 MSPFRLIYGKPCHLPVELEHKAHWA 1314