BLASTX nr result
ID: Anemarrhena21_contig00042758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00042758 (352 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010939721.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 ref|XP_008806388.1| PREDICTED: pentatricopeptide repeat-containi... 97 4e-18 ref|XP_008812226.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 ref|XP_010942641.1| PREDICTED: pentatricopeptide repeat-containi... 94 5e-17 ref|XP_011622177.1| PREDICTED: pentatricopeptide repeat-containi... 90 7e-16 ref|XP_011622176.1| PREDICTED: pentatricopeptide repeat-containi... 90 7e-16 ref|XP_011622175.1| PREDICTED: pentatricopeptide repeat-containi... 90 7e-16 gb|ERN02931.1| hypothetical protein AMTR_s00135p00094440 [Ambore... 90 7e-16 ref|XP_009380887.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-15 ref|XP_009409291.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 emb|CDY44801.1| BnaC02g00860D [Brassica napus] 85 2e-14 ref|XP_012464070.1| PREDICTED: pentatricopeptide repeat-containi... 84 5e-14 ref|XP_010491574.1| PREDICTED: pentatricopeptide repeat-containi... 83 6e-14 gb|AFK33523.1| unknown [Lotus japonicus] 83 6e-14 gb|KHG20865.1| hypothetical protein F383_27144 [Gossypium arbore... 82 1e-13 ref|XP_010452937.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 emb|CDO97403.1| unnamed protein product [Coffea canephora] 82 1e-13 ref|XP_006287851.1| hypothetical protein CARUB_v10001077mg [Caps... 82 1e-13 ref|XP_006287850.1| hypothetical protein CARUB_v10001077mg [Caps... 82 1e-13 ref|XP_010422981.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 >ref|XP_010939721.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial [Elaeis guineensis] Length = 409 Score = 98.2 bits (243), Expect = 2e-18 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 DDLRSR+ RLRF KRSATAAL+KWVGEG+KVT SELRQIAKDLKRSQRYKHALE Sbjct: 59 DDLRSRLFRLRFPKRSATAALDKWVGEGRKVTASELRQIAKDLKRSQRYKHALE 112 >ref|XP_008806388.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 [Phoenix dactylifera] Length = 517 Score = 97.1 bits (240), Expect = 4e-18 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 DDLRSR+ RLRF KRSATAAL+KWVGEG+KVT S+LRQIAKDLKRSQRYKHALE Sbjct: 40 DDLRSRLFRLRFPKRSATAALDKWVGEGRKVTASDLRQIAKDLKRSQRYKHALE 93 >ref|XP_008812226.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial [Phoenix dactylifera] Length = 409 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 DDLRSR+ RLRF KRSATAAL+KWVGEG+KVT +ELRQIA+DLKRSQRYKHALE Sbjct: 59 DDLRSRLFRLRFPKRSATAALDKWVGEGRKVTTTELRQIAQDLKRSQRYKHALE 112 >ref|XP_010942641.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 [Elaeis guineensis] Length = 536 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 +DLRSR+ RLRF KRSAT L+KWVGEG+KVT SELRQIAKDLKRSQRYKHALE Sbjct: 59 EDLRSRLFRLRFPKRSATVVLDKWVGEGRKVTASELRQIAKDLKRSQRYKHALE 112 >ref|XP_011622177.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial isoform X3 [Amborella trichopoda] Length = 368 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = +3 Query: 168 SSYPNANDDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHAL 347 +S P A D+LR+RI RLRF KRSA ALE+WVGEGK V+Q+ELR I KDLK+SQRYKHAL Sbjct: 85 ASSPVAEDNLRNRIFRLRFPKRSAVTALERWVGEGKPVSQAELRLIVKDLKKSQRYKHAL 144 Query: 348 E 350 E Sbjct: 145 E 145 >ref|XP_011622176.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial isoform X2 [Amborella trichopoda] Length = 445 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = +3 Query: 168 SSYPNANDDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHAL 347 +S P A D+LR+RI RLRF KRSA ALE+WVGEGK V+Q+ELR I KDLK+SQRYKHAL Sbjct: 85 ASSPVAEDNLRNRIFRLRFPKRSAVTALERWVGEGKPVSQAELRLIVKDLKKSQRYKHAL 144 Query: 348 E 350 E Sbjct: 145 E 145 >ref|XP_011622175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 isoform X1 [Amborella trichopoda] Length = 561 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = +3 Query: 168 SSYPNANDDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHAL 347 +S P A D+LR+RI RLRF KRSA ALE+WVGEGK V+Q+ELR I KDLK+SQRYKHAL Sbjct: 85 ASSPVAEDNLRNRIFRLRFPKRSAVTALERWVGEGKPVSQAELRLIVKDLKKSQRYKHAL 144 Query: 348 E 350 E Sbjct: 145 E 145 >gb|ERN02931.1| hypothetical protein AMTR_s00135p00094440 [Amborella trichopoda] Length = 398 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = +3 Query: 168 SSYPNANDDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHAL 347 +S P A D+LR+RI RLRF KRSA ALE+WVGEGK V+Q+ELR I KDLK+SQRYKHAL Sbjct: 38 ASSPVAEDNLRNRIFRLRFPKRSAVTALERWVGEGKPVSQAELRLIVKDLKKSQRYKHAL 97 Query: 348 E 350 E Sbjct: 98 E 98 >ref|XP_009380887.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial [Musa acuminata subsp. malaccensis] Length = 406 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 DDLR R+ RLR KRSATAAL++WVGEG+ V+ SELRQIAKDL+RSQRYKHALE Sbjct: 59 DDLRRRVFRLRLPKRSATAALDRWVGEGRAVSASELRQIAKDLRRSQRYKHALE 112 >ref|XP_009409291.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 [Musa acuminata subsp. malaccensis] Length = 536 Score = 86.7 bits (213), Expect = 6e-15 Identities = 53/107 (49%), Positives = 61/107 (57%), Gaps = 6/107 (5%) Frame = +3 Query: 48 LRSLPF------RSFSSGTPISFTLSIXXXXXXXXXXXXXXXXXXXSSYPNANDDLRSRI 209 LR+ PF R FSSG P S L++ + D+LRSRI Sbjct: 24 LRTSPFALLESSRPFSSGPPTSEVLAVEEGTAA------------------SEDNLRSRI 65 Query: 210 LRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 RLR KRSAT AL++W GEG+ VT SELRQI KDL RSQRYKHALE Sbjct: 66 FRLRLPKRSATDALDRWAGEGRTVTASELRQITKDLMRSQRYKHALE 112 >emb|CDY44801.1| BnaC02g00860D [Brassica napus] Length = 404 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/58 (67%), Positives = 48/58 (82%) Frame = +3 Query: 177 PNANDDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 P DDLRSRI RLR KRSAT LEKWVGEG ++T +ELR+I+K+L+R++RYKHALE Sbjct: 47 PEEKDDLRSRIFRLRLPKRSATTVLEKWVGEGNQITVNELREISKELRRTRRYKHALE 104 >ref|XP_012464070.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial [Gossypium raimondii] gi|763812751|gb|KJB79603.1| hypothetical protein B456_013G057100 [Gossypium raimondii] Length = 393 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/54 (70%), Positives = 48/54 (88%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 DDLRSRI RLR KRSAT+ +EKWVGEG +++ S+LRQI+KDL++SQR+KHALE Sbjct: 43 DDLRSRIFRLRLPKRSATSVIEKWVGEGNRISISDLRQISKDLRKSQRFKHALE 96 >ref|XP_010491574.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Camelina sativa] Length = 416 Score = 83.2 bits (204), Expect = 6e-14 Identities = 39/61 (63%), Positives = 48/61 (78%) Frame = +3 Query: 168 SSYPNANDDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHAL 347 SS DDLRSRI RLR KRSAT LEKW+GEG ++T +ELR I+K+L+R++RYKHAL Sbjct: 56 SSESEEKDDLRSRIFRLRLPKRSATTVLEKWIGEGNQITVNELRDISKELRRTRRYKHAL 115 Query: 348 E 350 E Sbjct: 116 E 116 >gb|AFK33523.1| unknown [Lotus japonicus] Length = 358 Score = 83.2 bits (204), Expect = 6e-14 Identities = 42/61 (68%), Positives = 48/61 (78%) Frame = +3 Query: 168 SSYPNANDDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHAL 347 + + ++DDLRSRILRLR KRSAT L KWV EG VT SELR IAK+L+RSQRYKHAL Sbjct: 43 TDFVESDDDLRSRILRLRLPKRSATNILHKWVLEGNSVTVSELRDIAKELRRSQRYKHAL 102 Query: 348 E 350 E Sbjct: 103 E 103 >gb|KHG20865.1| hypothetical protein F383_27144 [Gossypium arboreum] gi|728841544|gb|KHG20987.1| hypothetical protein F383_28000 [Gossypium arboreum] Length = 393 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/54 (70%), Positives = 47/54 (87%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 DDLRSRI +LR KRSAT +EKWVGEG +V+ S+LRQI+KDL++SQR+KHALE Sbjct: 43 DDLRSRIFQLRLPKRSATTVIEKWVGEGNRVSISDLRQISKDLRKSQRFKHALE 96 >ref|XP_010452937.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Camelina sativa] Length = 411 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 DDLRSRI RLR KRSAT LEKWVGEG ++T +ELR I+K+L+R++RYKHALE Sbjct: 58 DDLRSRIFRLRLPKRSATTVLEKWVGEGNQITVNELRDISKELRRTRRYKHALE 111 >emb|CDO97403.1| unnamed protein product [Coffea canephora] Length = 409 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = +3 Query: 171 SYPNANDDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 S NDDL+SRI RLR KRSAT L +WV EG ++T S+LRQI+KDL++SQRYKHALE Sbjct: 52 SETTTNDDLKSRITRLRLPKRSATNVLHRWVSEGNRITISDLRQISKDLRKSQRYKHALE 111 >ref|XP_006287851.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] gi|482556557|gb|EOA20749.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] Length = 412 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 DDLRSRI RLR KRSAT LEKWVGEG ++T +ELR I+K+L+R++RYKHALE Sbjct: 59 DDLRSRIFRLRLPKRSATTVLEKWVGEGNQITVNELRDISKELRRTRRYKHALE 112 >ref|XP_006287850.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] gi|482556556|gb|EOA20748.1| hypothetical protein CARUB_v10001077mg [Capsella rubella] Length = 401 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 DDLRSRI RLR KRSAT LEKWVGEG ++T +ELR I+K+L+R++RYKHALE Sbjct: 48 DDLRSRIFRLRLPKRSATTVLEKWVGEGNQITVNELRDISKELRRTRRYKHALE 101 >ref|XP_010422981.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial [Camelina sativa] Length = 414 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/54 (68%), Positives = 46/54 (85%) Frame = +3 Query: 189 DDLRSRILRLRFSKRSATAALEKWVGEGKKVTQSELRQIAKDLKRSQRYKHALE 350 DDLRSRI RLR KRSAT LEKW+GEG ++T +ELR I+K+L+R++RYKHALE Sbjct: 61 DDLRSRIFRLRLPKRSATTVLEKWIGEGNQITVNELRDISKELRRTRRYKHALE 114