BLASTX nr result
ID: Anemarrhena21_contig00042753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00042753 (225 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010931853.1| PREDICTED: putative F-box protein At5g55150 ... 59 1e-06 >ref|XP_010931853.1| PREDICTED: putative F-box protein At5g55150 [Elaeis guineensis] Length = 378 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -2 Query: 200 RSFFALSDNKIHTLHLPETRRRNLYCSAYGWLLTAGYE-KSFSLLNPITRTYISL 39 RSFF+LS N IHTL LP T + + S++GWLL A ++ K+ SLLNPIT I L Sbjct: 75 RSFFSLSTNSIHTLSLPNTCCKEILASSHGWLLLADFKTKAISLLNPITEAQIQL 129