BLASTX nr result
ID: Anemarrhena21_contig00042598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00042598 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002850985.1| conserved hypothetical protein [Arthroderma ... 64 3e-08 gb|EFX01836.1| hypothetical protein CMQ_8302 [Grosmannia clavige... 60 6e-07 ref|XP_002151769.1| conserved hypothetical protein [Talaromyces ... 60 8e-07 ref|XP_001265490.1| hypothetical protein NFIA_023040 [Neosartory... 57 4e-06 >ref|XP_002850985.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|238838539|gb|EEQ28201.1| conserved hypothetical protein [Arthroderma otae CBS 113480] Length = 93 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 260 LSGILTSGN-CDASSISEHLSNFRSCCGGQSDCDFPSKRDGK 138 LSGI +G+ C ASSISEHLSNFRSCCGGQSDCD+P D K Sbjct: 41 LSGIFNNGDDCAASSISEHLSNFRSCCGGQSDCDYPLVGDVK 82 >gb|EFX01836.1| hypothetical protein CMQ_8302 [Grosmannia clavigera kw1407] Length = 76 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/35 (74%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = -2 Query: 260 LSGILTSGN-CDASSISEHLSNFRSCCGGQSDCDF 159 L+G+ GN C+ASSIS+HLSNFRSCCGGQSDCD+ Sbjct: 42 LNGVFRYGNDCEASSISQHLSNFRSCCGGQSDCDY 76 >ref|XP_002151769.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|210066676|gb|EEA20769.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|679992066|gb|KFX44769.1| hypothetical protein GQ26_0260430 [Talaromyces marneffei PM1] Length = 105 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -2 Query: 260 LSGILTSGN-CDASSISEHLSNFRSCCGGQSDCDFP 156 L G+ GN C ASSISEHLSNFR CCGGQSDCD+P Sbjct: 42 LHGVFRYGNDCAASSISEHLSNFRRCCGGQSDCDYP 77 >ref|XP_001265490.1| hypothetical protein NFIA_023040 [Neosartorya fischeri NRRL 181] gi|119413652|gb|EAW23593.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 102 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -2 Query: 260 LSGILTSGN-CDASSISEHLSNFRSCCGGQSDCDFP 156 L GI GN C A SISEHLSNFR CCGG SDCD+P Sbjct: 42 LRGIFRYGNDCQAGSISEHLSNFRRCCGGSSDCDYP 77