BLASTX nr result
ID: Anemarrhena21_contig00042056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00042056 (236 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086789.1| PREDICTED: chlorophyll a-b binding protein, ... 87 4e-15 ref|XP_011002123.1| PREDICTED: chlorophyll a-b binding protein 7... 81 3e-13 ref|XP_011036086.1| PREDICTED: chlorophyll a-b binding protein 7... 81 3e-13 ref|XP_012085680.1| PREDICTED: chlorophyll a-b binding protein 7... 80 4e-13 ref|XP_002299309.1| chlorophyll a/b-binding protein type II prec... 80 5e-13 gb|ABK95596.1| unknown [Populus trichocarpa] 80 5e-13 gb|EPS71951.1| chlorophyll a-b binding protein 7, chloroplastic,... 78 2e-12 ref|XP_012851204.1| PREDICTED: chlorophyll a-b binding protein, ... 78 3e-12 gb|EYU25891.1| hypothetical protein MIMGU_mgv1a025195mg, partial... 78 3e-12 ref|XP_006352516.1| PREDICTED: chlorophyll a-b binding protein 7... 77 5e-12 ref|XP_011020754.1| PREDICTED: chlorophyll a-b binding protein 7... 76 8e-12 ref|NP_001296176.1| chlorophyll a-b binding protein 7, chloropla... 76 8e-12 gb|ABK95601.1| unknown [Populus trichocarpa] 76 1e-11 ref|XP_002303791.1| chlorophyll a/b-binding protein type II prec... 75 2e-11 ref|XP_002514914.1| chlorophyll A/B binding protein, putative [R... 74 3e-11 ref|XP_009787153.1| PREDICTED: chlorophyll a-b binding protein, ... 74 4e-11 ref|XP_007044017.1| Chlorophyll a-b binding protein 7, chloropla... 74 4e-11 gb|KJB50348.1| hypothetical protein B456_008G165200 [Gossypium r... 73 9e-11 gb|KJB50347.1| hypothetical protein B456_008G165200 [Gossypium r... 73 9e-11 ref|XP_012438327.1| PREDICTED: chlorophyll a-b binding protein 7... 73 9e-11 >ref|XP_011086789.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Sesamum indicum] Length = 271 Score = 87.0 bits (214), Expect = 4e-15 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 ATKASF GRKLRVSK A +G RSVTVC+A DPDRPLWFPGSTPPPW Sbjct: 31 ATKASFFGGRKLRVSKFAAPSGTRSVTVCAAADPDRPLWFPGSTPPPW 78 >ref|XP_011002123.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Populus euphratica] Length = 269 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 +TKASFLSG+KLR+ + T RSVTVC A DPDRPLWFPGSTPPPW Sbjct: 29 STKASFLSGKKLRLKRYTTPTAARSVTVCVAADPDRPLWFPGSTPPPW 76 >ref|XP_011036086.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like [Populus euphratica] Length = 269 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 +TKASFLSG+KLR+ + T RSVTVC A DPDRPLWFPGSTPPPW Sbjct: 29 STKASFLSGKKLRLKRYTTPTAARSVTVCVAADPDRPLWFPGSTPPPW 76 >ref|XP_012085680.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Jatropha curcas] gi|643714139|gb|KDP26804.1| hypothetical protein JCGZ_17962 [Jatropha curcas] Length = 270 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/49 (77%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGV-RSVTVCSAPDPDRPLWFPGSTPPPW 1 ATKASFLSG+KLR+ N +S V RSVTVC+A DPDRPLWFPGSTPPPW Sbjct: 29 ATKASFLSGKKLRLRSNTSSPVVSRSVTVCAAADPDRPLWFPGSTPPPW 77 >ref|XP_002299309.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa] gi|222846567|gb|EEE84114.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa] Length = 272 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 +TKASFLSG+KLR+ K RSVTVC A DPDRPLWFPGSTPPPW Sbjct: 32 STKASFLSGKKLRLKKYTAPTAARSVTVCVAADPDRPLWFPGSTPPPW 79 >gb|ABK95596.1| unknown [Populus trichocarpa] Length = 269 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 +TKASFLSG+KLR+ K RSVTVC A DPDRPLWFPGSTPPPW Sbjct: 29 STKASFLSGKKLRLKKYTAPTAARSVTVCVAADPDRPLWFPGSTPPPW 76 >gb|EPS71951.1| chlorophyll a-b binding protein 7, chloroplastic, partial [Genlisea aurea] Length = 259 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -3 Query: 156 SSTRATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 SS ATKASF RKLRV K +T++ RSV+VC A DPDRPLWFPGSTPP W Sbjct: 15 SSVGATKASFFGARKLRVGKFSTTSSSRSVSVCVAADPDRPLWFPGSTPPAW 66 >ref|XP_012851204.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic isoform X1 [Erythranthe guttatus] gi|848902579|ref|XP_012851205.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic isoform X2 [Erythranthe guttatus] Length = 270 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 ATKASF GRKLRVSK A + RSV VC A DPDRP+WFPGSTPP W Sbjct: 30 ATKASFFGGRKLRVSKFAAPSNTRSVAVCVAADPDRPIWFPGSTPPEW 77 >gb|EYU25891.1| hypothetical protein MIMGU_mgv1a025195mg, partial [Erythranthe guttata] Length = 250 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 ATKASF GRKLRVSK A + RSV VC A DPDRP+WFPGSTPP W Sbjct: 10 ATKASFFGGRKLRVSKFAAPSNTRSVAVCVAADPDRPIWFPGSTPPEW 57 >ref|XP_006352516.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like [Solanum tuberosum] Length = 270 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/49 (73%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVT-VCSAPDPDRPLWFPGSTPPPW 1 ATKASFL GR+LRVSK +T+ RS T VC A +PDRPLWFPGSTPPPW Sbjct: 29 ATKASFLGGRRLRVSKYSTTPAARSATTVCVAAEPDRPLWFPGSTPPPW 77 >ref|XP_011020754.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like [Populus euphratica] Length = 269 Score = 76.3 bits (186), Expect = 8e-12 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 +TKASFL G+KLR+ + RSVTVC A DPDRPLWFPGSTPPPW Sbjct: 29 STKASFLRGKKLRLKTYTSPTAARSVTVCVAADPDRPLWFPGSTPPPW 76 >ref|NP_001296176.1| chlorophyll a-b binding protein 7, chloroplastic [Solanum lycopersicum] gi|115765|sp|P10708.1|CB12_SOLLC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; AltName: Full=LHCI type II CAB-7; Flags: Precursor gi|19180|emb|CAA32197.1| chlorophyll a/b-binding protein [Solanum lycopersicum] gi|170431|gb|AAA34159.1| chlorophyll a/b-binding protein [Solanum lycopersicum] gi|226546|prf||1601518A chlorophyll a/b binding protein II Length = 270 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = -3 Query: 141 TKASFLSGRKLRVSKNATSNGVRSVT-VCSAPDPDRPLWFPGSTPPPW 1 TKASFL GR+LRVSK +T+ RS T VC A DPDRPLWFPGSTPPPW Sbjct: 30 TKASFLGGRRLRVSKYSTTPTARSATTVCVAADPDRPLWFPGSTPPPW 77 >gb|ABK95601.1| unknown [Populus trichocarpa] Length = 269 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 +TKASFL G+KLR+ + RSVTVC A DPDRPLWFPGSTPPPW Sbjct: 29 STKASFLRGKKLRLRTYTSPTAARSVTVCVAADPDRPLWFPGSTPPPW 76 >ref|XP_002303791.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa] gi|222841223|gb|EEE78770.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa] Length = 269 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 +TKASFL G KLR+ + RSVTVC A DPDRPLWFPGSTPPPW Sbjct: 29 STKASFLRGEKLRLRTYTSPTAARSVTVCVAADPDRPLWFPGSTPPPW 76 >ref|XP_002514914.1| chlorophyll A/B binding protein, putative [Ricinus communis] gi|223545965|gb|EEF47468.1| chlorophyll A/B binding protein, putative [Ricinus communis] Length = 270 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -3 Query: 156 SSTRATKASFLSGRKLRVSKNATSN-GVRSVTVCSAPDPDRPLWFPGSTPPPW 1 S+ ATKASFLSG++L V K+ + RSVTVC+ DPDRPLWFPGSTPPPW Sbjct: 25 STVGATKASFLSGKRLTVRKHTSPVVASRSVTVCAVADPDRPLWFPGSTPPPW 77 >ref|XP_009787153.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana sylvestris] gi|698567424|ref|XP_009773771.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana sylvestris] Length = 270 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/49 (71%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -3 Query: 144 ATKASFLSGRKLRVSKNATSNGVRSVTVCS-APDPDRPLWFPGSTPPPW 1 ATKASFL G++LRVSK+ G RSV V + A DPDRPLWFPGSTPPPW Sbjct: 29 ATKASFLGGKRLRVSKHVAPAGSRSVAVSAVAADPDRPLWFPGSTPPPW 77 >ref|XP_007044017.1| Chlorophyll a-b binding protein 7, chloroplastic [Theobroma cacao] gi|508707952|gb|EOX99848.1| Chlorophyll a-b binding protein 7, chloroplastic [Theobroma cacao] Length = 271 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = -3 Query: 144 ATKASFLSGRKLRVSK--NATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 ATKASFLSG+KLR ++ +A G R V VC+A DP+RPLWFPGSTPPPW Sbjct: 29 ATKASFLSGKKLRSARKYSAAPAGARPVAVCAAADPNRPLWFPGSTPPPW 78 >gb|KJB50348.1| hypothetical protein B456_008G165200 [Gossypium raimondii] Length = 268 Score = 72.8 bits (177), Expect = 9e-11 Identities = 34/53 (64%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = -3 Query: 156 SSTRATKASFLSGRKLR-VSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 S R TKASFL+G+KLR V K R+V VC+ DPDRPLWFPGSTPPPW Sbjct: 25 SVVRTTKASFLTGKKLRSVKKYTKPAAARTVPVCAVADPDRPLWFPGSTPPPW 77 >gb|KJB50347.1| hypothetical protein B456_008G165200 [Gossypium raimondii] Length = 313 Score = 72.8 bits (177), Expect = 9e-11 Identities = 34/53 (64%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = -3 Query: 156 SSTRATKASFLSGRKLR-VSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 S R TKASFL+G+KLR V K R+V VC+ DPDRPLWFPGSTPPPW Sbjct: 25 SVVRTTKASFLTGKKLRSVKKYTKPAAARTVPVCAVADPDRPLWFPGSTPPPW 77 >ref|XP_012438327.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like [Gossypium raimondii] gi|763783275|gb|KJB50346.1| hypothetical protein B456_008G165200 [Gossypium raimondii] Length = 270 Score = 72.8 bits (177), Expect = 9e-11 Identities = 34/53 (64%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = -3 Query: 156 SSTRATKASFLSGRKLR-VSKNATSNGVRSVTVCSAPDPDRPLWFPGSTPPPW 1 S R TKASFL+G+KLR V K R+V VC+ DPDRPLWFPGSTPPPW Sbjct: 25 SVVRTTKASFLTGKKLRSVKKYTKPAAARTVPVCAVADPDRPLWFPGSTPPPW 77