BLASTX nr result
ID: Anemarrhena21_contig00041612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00041612 (393 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB55338.1| hypothetical protein 16.t00009 [Asparagus officin... 57 6e-06 >gb|ABB55338.1| hypothetical protein 16.t00009 [Asparagus officinalis] Length = 1322 Score = 56.6 bits (135), Expect = 6e-06 Identities = 40/132 (30%), Positives = 53/132 (40%), Gaps = 2/132 (1%) Frame = -1 Query: 393 HLSLSYFNSILSPRQMKWDLVWGIPNVTEGRFTENGVEPAGPPETVTGLFP--LSRSEDA 220 H SL+ R+M W L +V G T V P + + GL P L Sbjct: 211 HRSLTELRRQAVKREMSWSLTKEHESVHCGYITHQAV-PGSSRDHIVGLHPGVLGLDTPP 269 Query: 219 SNNRSATVSTFLQRFLSLGGNYTTSEVRLPGWVDKRHQLWWHSLSSTVLAYFEGELKSLN 40 N T ST R LG R GWV + WW ++ VL+ + EL + Sbjct: 270 RNEFLTTASTLRNRLAILGREMPAPRHRFYGWVHSLDRFWWARMTKYVLSRWSEELHACG 329 Query: 39 LFEAVRATTCGL 4 L+ A+RAT GL Sbjct: 330 LYAAIRATMHGL 341