BLASTX nr result
ID: Anemarrhena21_contig00040525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00040525 (301 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008807161.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-18 ref|XP_008807162.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-18 ref|XP_010926893.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-18 ref|XP_009393287.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-15 ref|XP_009393288.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-15 ref|XP_007008764.1| Pentatricopeptide repeat-containing protein ... 50 2e-10 ref|XP_004495567.1| PREDICTED: pentatricopeptide repeat-containi... 52 6e-10 ref|XP_012456387.1| PREDICTED: pentatricopeptide repeat-containi... 51 3e-09 ref|XP_012456388.1| PREDICTED: pentatricopeptide repeat-containi... 51 3e-09 gb|KJB74436.1| hypothetical protein B456_011G295200 [Gossypium r... 51 3e-09 ref|XP_008392321.1| PREDICTED: pentatricopeptide repeat-containi... 47 4e-09 ref|XP_008351619.1| PREDICTED: pentatricopeptide repeat-containi... 47 4e-09 ref|XP_002300553.2| hypothetical protein POPTR_0001s46420g [Popu... 47 5e-09 gb|KHG09579.1| Pentatricopeptide repeat-containing, chloroplasti... 50 6e-09 ref|XP_011005323.1| PREDICTED: pentatricopeptide repeat-containi... 47 1e-08 ref|XP_011005325.1| PREDICTED: pentatricopeptide repeat-containi... 47 1e-08 ref|XP_003539000.1| PREDICTED: pentatricopeptide repeat-containi... 45 4e-08 ref|XP_008225762.1| PREDICTED: pentatricopeptide repeat-containi... 44 4e-08 gb|KCW76642.1| hypothetical protein EUGRSUZ_D01024 [Eucalyptus g... 49 4e-08 gb|KHN39846.1| Pentatricopeptide repeat-containing protein, chlo... 45 4e-08 >ref|XP_008807161.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Phoenix dactylifera] Length = 865 Score = 61.6 bits (148), Expect(2) = 2e-18 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -2 Query: 171 MAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 MAAISCI VHQ +MNAFS+K+WLNLL++ + K +TI RL ++L +LI E Sbjct: 782 MAAISCIDVHQEIEMNAFSKKSWLNLLKSKSSCLKKNTIVRLYHKLKDLIAE 833 Score = 57.4 bits (137), Expect(2) = 2e-18 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 QV+ETTW+HLI FG PPPII+ERFCIKL +D+ Sbjct: 747 QVLETTWEHLIHFGRIPPPPIIKERFCIKLTEDE 780 >ref|XP_008807162.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X2 [Phoenix dactylifera] Length = 854 Score = 61.6 bits (148), Expect(2) = 2e-18 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -2 Query: 171 MAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 MAAISCI VHQ +MNAFS+K+WLNLL++ + K +TI RL ++L +LI E Sbjct: 771 MAAISCIDVHQEIEMNAFSKKSWLNLLKSKSSCLKKNTIVRLYHKLKDLIAE 822 Score = 57.4 bits (137), Expect(2) = 2e-18 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 QV+ETTW+HLI FG PPPII+ERFCIKL +D+ Sbjct: 736 QVLETTWEHLIHFGRIPPPPIIKERFCIKLTEDE 769 >ref|XP_010926893.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Elaeis guineensis] Length = 865 Score = 63.9 bits (154), Expect(2) = 3e-18 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -2 Query: 171 MAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 MAAISCI VHQ +M+AFS+K+WLNLL+N + K +TI RLS++L +LI E Sbjct: 782 MAAISCIDVHQEIEMDAFSKKSWLNLLKNKSSCLKKNTIVRLSHKLKDLIAE 833 Score = 54.3 bits (129), Expect(2) = 3e-18 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = -3 Query: 281 QRQVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 + QV+E +W+HLI FG PPPII+ERFCIKL +D+ Sbjct: 745 KEQVLEMSWEHLIHFGRIPPPPIIKERFCIKLMEDE 780 >ref|XP_009393287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] Length = 1105 Score = 56.6 bits (135), Expect(2) = 1e-15 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 QV+E+TW HL+ FG PPPII+ERFCIKL +DD Sbjct: 981 QVLESTWKHLVRFGRVPPPPIIKERFCIKLMEDD 1014 Score = 52.8 bits (125), Expect(2) = 1e-15 Identities = 25/52 (48%), Positives = 36/52 (69%) Frame = -2 Query: 171 MAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 +AAI+CI +HQ + AFSE++WL LL NA RFK+ + RL+ EL+ I + Sbjct: 1016 VAAIACIDIHQEIDILAFSERSWLKLLNGNAHRFKSGIMLRLAIELDAFIAQ 1067 >ref|XP_009393288.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X2 [Musa acuminata subsp. malaccensis] Length = 1086 Score = 56.6 bits (135), Expect(2) = 1e-15 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 QV+E+TW HL+ FG PPPII+ERFCIKL +DD Sbjct: 962 QVLESTWKHLVRFGRVPPPPIIKERFCIKLMEDD 995 Score = 52.8 bits (125), Expect(2) = 1e-15 Identities = 25/52 (48%), Positives = 36/52 (69%) Frame = -2 Query: 171 MAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 +AAI+CI +HQ + AFSE++WL LL NA RFK+ + RL+ EL+ I + Sbjct: 997 VAAIACIDIHQEIDILAFSERSWLKLLNGNAHRFKSGIMLRLAIELDAFIAQ 1048 >ref|XP_007008764.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] gi|508725677|gb|EOY17574.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 845 Score = 50.4 bits (119), Expect(2) = 2e-10 Identities = 20/52 (38%), Positives = 35/52 (67%) Frame = -2 Query: 174 HMAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIG 19 +++A+SCI +H ++ AFS+ W N ++NA RF+ D I L +E+ N++G Sbjct: 750 YISALSCITIHPLRELQAFSKSAWSNFFKDNASRFRKDIIVGLVDEVENILG 801 Score = 41.6 bits (96), Expect(2) = 2e-10 Identities = 16/34 (47%), Positives = 25/34 (73%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 ++IETTW+H+ P P+I+ERFC+KL+ +D Sbjct: 716 ELIETTWEHMARADRTPPLPLIKERFCMKLEKND 749 >ref|XP_004495567.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Cicer arietinum] Length = 883 Score = 51.6 bits (122), Expect(2) = 6e-10 Identities = 22/51 (43%), Positives = 32/51 (62%) Frame = -2 Query: 174 HMAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLI 22 ++AA+ CI H FS+ +WLNL + N+ RF+ DT+ RL N +NLI Sbjct: 790 YVAALKCITSHTPKDFEPFSKSSWLNLFKENSHRFRKDTVVRLMNAASNLI 840 Score = 38.5 bits (88), Expect(2) = 6e-10 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = -3 Query: 281 QRQVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 + +++E TW HL P +I+ERFC KL++DD Sbjct: 754 KEELLEITWKHLAVTDRIPPVSVIKERFCTKLENDD 789 >ref|XP_012456387.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Gossypium raimondii] Length = 809 Score = 51.2 bits (121), Expect(2) = 3e-09 Identities = 21/53 (39%), Positives = 36/53 (67%) Frame = -2 Query: 174 HMAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 + +A+SCI +H S++ A S+ WLNL ++NA RF+ +TI L ++ +IG+ Sbjct: 733 YASAVSCITIHPASELQALSKSVWLNLYKDNASRFQQETIIGLVEAVDMIIGK 785 Score = 36.6 bits (83), Expect(2) = 3e-09 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 +++ETTW+ + P P+I+ERFC+KL+ +D Sbjct: 699 ELLETTWEEMDRAERTPPLPLIKERFCMKLEKND 732 >ref|XP_012456388.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X2 [Gossypium raimondii] gi|763807499|gb|KJB74437.1| hypothetical protein B456_011G295200 [Gossypium raimondii] Length = 803 Score = 51.2 bits (121), Expect(2) = 3e-09 Identities = 21/53 (39%), Positives = 36/53 (67%) Frame = -2 Query: 174 HMAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 + +A+SCI +H S++ A S+ WLNL ++NA RF+ +TI L ++ +IG+ Sbjct: 727 YASAVSCITIHPASELQALSKSVWLNLYKDNASRFQQETIIGLVEAVDMIIGK 779 Score = 36.6 bits (83), Expect(2) = 3e-09 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 +++ETTW+ + P P+I+ERFC+KL+ +D Sbjct: 693 ELLETTWEEMDRAERTPPLPLIKERFCMKLEKND 726 >gb|KJB74436.1| hypothetical protein B456_011G295200 [Gossypium raimondii] Length = 648 Score = 51.2 bits (121), Expect(2) = 3e-09 Identities = 21/53 (39%), Positives = 36/53 (67%) Frame = -2 Query: 174 HMAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 + +A+SCI +H S++ A S+ WLNL ++NA RF+ +TI L ++ +IG+ Sbjct: 572 YASAVSCITIHPASELQALSKSVWLNLYKDNASRFQQETIIGLVEAVDMIIGK 624 Score = 36.6 bits (83), Expect(2) = 3e-09 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 +++ETTW+ + P P+I+ERFC+KL+ +D Sbjct: 538 ELLETTWEEMDRAERTPPLPLIKERFCMKLEKND 571 >ref|XP_008392321.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic-like [Malus domestica] Length = 916 Score = 47.4 bits (111), Expect(2) = 4e-09 Identities = 22/51 (43%), Positives = 32/51 (62%) Frame = -2 Query: 174 HMAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLI 22 + AA+SCI ++ AFS+ WL L + NA RF+NDT RL +E + L+ Sbjct: 813 YAAALSCITTQNLGELQAFSKTAWLKLFKENAERFQNDTFVRLVDEGSILV 863 Score = 40.0 bits (92), Expect(2) = 4e-09 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 ++++ TW HL PPP+++ERFC KL+ DD Sbjct: 779 ELLDMTWMHLTEADRIPPPPLVKERFCTKLEKDD 812 >ref|XP_008351619.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic-like [Malus domestica] Length = 356 Score = 47.4 bits (111), Expect(2) = 4e-09 Identities = 22/51 (43%), Positives = 32/51 (62%) Frame = -2 Query: 174 HMAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLI 22 + AA+SCI ++ AFS+ WL L + NA RF+NDT RL +E + L+ Sbjct: 253 YAAALSCITTQNLGELQAFSKTAWLKLFKENAERFQNDTFVRLVDEGSILV 303 Score = 40.0 bits (92), Expect(2) = 4e-09 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 ++++ TW HL PPP+++ERFC KL+ DD Sbjct: 219 ELLDMTWMHLTEADRIPPPPLVKERFCTKLEKDD 252 >ref|XP_002300553.2| hypothetical protein POPTR_0001s46420g [Populus trichocarpa] gi|550350020|gb|EEE85358.2| hypothetical protein POPTR_0001s46420g [Populus trichocarpa] Length = 1112 Score = 47.0 bits (110), Expect(2) = 5e-09 Identities = 19/51 (37%), Positives = 31/51 (60%) Frame = -2 Query: 168 AAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 +A++CI + + AF + WLNL + NA RF+ DT+ RL +E+ L + Sbjct: 1031 SALACITTNSAGESQAFCKSAWLNLFEENAQRFRKDTLMRLMHEVRVLAAQ 1081 Score = 40.0 bits (92), Expect(2) = 5e-09 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 +V+E TW HL PPP+++ERFC+ L+ +D Sbjct: 995 EVLEITWKHLAQEDRIPPPPLVKERFCMMLEKED 1028 >gb|KHG09579.1| Pentatricopeptide repeat-containing, chloroplastic -like protein [Gossypium arboreum] Length = 804 Score = 50.1 bits (118), Expect(2) = 6e-09 Identities = 22/53 (41%), Positives = 34/53 (64%) Frame = -2 Query: 174 HMAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 + +A+SCI +H S++ A S+ WLNL + NA RF+ TI L E+ +IG+ Sbjct: 728 YRSAVSCIAIHPVSELQALSKSVWLNLFKENACRFQQKTIIGLVEEVEMIIGK 780 Score = 36.6 bits (83), Expect(2) = 6e-09 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 +++ETTW+ + P P+I+ERFC+KL+ +D Sbjct: 694 ELLETTWEEMARDKRIPPLPLIKERFCMKLEKND 727 >ref|XP_011005323.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Populus euphratica] gi|743922503|ref|XP_011005324.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Populus euphratica] Length = 1142 Score = 46.6 bits (109), Expect(2) = 1e-08 Identities = 19/51 (37%), Positives = 31/51 (60%) Frame = -2 Query: 168 AAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 +A++CI + + AF + WLNL + NA RF+ DT+ RL +E+ L + Sbjct: 1061 SALACITTNSAGEPQAFCKSAWLNLFEENAQRFRKDTLMRLMHEVRVLAAQ 1111 Score = 39.3 bits (90), Expect(2) = 1e-08 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 +V+E TW HL PPP+++ERFC+ L+ +D Sbjct: 1025 EVLEITWKHLEQEDRIPPPPLVKERFCMMLEKED 1058 >ref|XP_011005325.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X2 [Populus euphratica] Length = 1025 Score = 46.6 bits (109), Expect(2) = 1e-08 Identities = 19/51 (37%), Positives = 31/51 (60%) Frame = -2 Query: 168 AAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLIGE 16 +A++CI + + AF + WLNL + NA RF+ DT+ RL +E+ L + Sbjct: 944 SALACITTNSAGEPQAFCKSAWLNLFEENAQRFRKDTLMRLMHEVRVLAAQ 994 Score = 39.3 bits (90), Expect(2) = 1e-08 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 +V+E TW HL PPP+++ERFC+ L+ +D Sbjct: 908 EVLEITWKHLEQEDRIPPPPLVKERFCMMLEKED 941 >ref|XP_003539000.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic-like [Glycine max] Length = 893 Score = 45.4 bits (106), Expect(2) = 4e-08 Identities = 19/51 (37%), Positives = 33/51 (64%) Frame = -2 Query: 174 HMAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLI 22 ++AA++CI + + FS+ +WL L + N+ RF+ DTI L NE +N++ Sbjct: 807 YVAALTCIINNPPKDLQPFSKSSWLKLFKENSQRFQKDTIVGLMNEASNIV 857 Score = 38.5 bits (88), Expect(2) = 4e-08 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -3 Query: 269 IETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 +E TW HL P P+I+ERFC KL+ DD Sbjct: 775 LEITWKHLTDTDRIPPAPLIKERFCAKLEKDD 806 >ref|XP_008225762.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Prunus mume] Length = 902 Score = 44.3 bits (103), Expect(2) = 4e-08 Identities = 16/34 (47%), Positives = 25/34 (73%) Frame = -3 Query: 275 QVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 ++++ TW HL G + PPP+++ERFC KL+ DD Sbjct: 763 ELLDITWTHLTEAGRSPPPPLVKERFCTKLEKDD 796 Score = 39.7 bits (91), Expect(2) = 4e-08 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -2 Query: 174 HMAAISCI-KVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLI 22 + AA+SCI + G FS+ WL L + NA RF+ DT RL +E + LI Sbjct: 797 YAAALSCITNPNLGELRTFFSKNAWLKLFKENAERFQKDTFVRLVHEGSILI 848 >gb|KCW76642.1| hypothetical protein EUGRSUZ_D01024 [Eucalyptus grandis] Length = 838 Score = 48.9 bits (115), Expect(2) = 4e-08 Identities = 20/39 (51%), Positives = 29/39 (74%) Frame = -3 Query: 290 ALQQRQVIETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 A QQ ++ETTW+HL+ +LP P+I+ERFC+ L+ DD Sbjct: 725 ARQQYGLLETTWNHLVWADRSLPLPLIKERFCVMLEKDD 763 Score = 35.0 bits (79), Expect(2) = 4e-08 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -2 Query: 168 AAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTI 55 AA+SC+ H S+ FS +WL L ++NA R + +++ Sbjct: 766 AALSCLVNHTSSESQGFSRISWLKLFKHNAYRIRRESL 803 >gb|KHN39846.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 649 Score = 45.4 bits (106), Expect(2) = 4e-08 Identities = 19/51 (37%), Positives = 33/51 (64%) Frame = -2 Query: 174 HMAAISCIKVHQGSKMNAFSEKTWLNLLQNNAPRFKNDTIFRLSNELNNLI 22 ++AA++CI + + FS+ +WL L + N+ RF+ DTI L NE +N++ Sbjct: 563 YVAALTCIINNPPKDLQPFSKSSWLKLFKENSQRFQKDTIVGLMNEASNIV 613 Score = 38.5 bits (88), Expect(2) = 4e-08 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -3 Query: 269 IETTWDHLICFGHALPPPIIQERFCIKLQDDD 174 +E TW HL P P+I+ERFC KL+ DD Sbjct: 531 LEITWKHLTDTDRIPPAPLIKERFCAKLEKDD 562