BLASTX nr result
ID: Anemarrhena21_contig00040510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00040510 (481 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008779859.1| PREDICTED: zinc finger BED domain-containing... 40 7e-06 >ref|XP_008779859.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 160 Score = 40.4 bits (93), Expect(2) = 7e-06 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = -2 Query: 222 DMDDKYFDVLSWWGKNANTFLILSRMGHDMSTI 124 D+++K FD+L+WW NA + ILSRM D+ I Sbjct: 60 DLENKEFDILAWWKSNAAVYPILSRMAQDVLAI 92 Score = 35.8 bits (81), Expect(2) = 7e-06 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = -3 Query: 329 GSGDLQNV--KRKLHEAFSQFKSQSAQ*RPTRGELDAXI 219 G GD+ +V K+K F+QF+SQS+ RP R ELD+ + Sbjct: 15 GQGDISSVSSKKKFGMDFAQFRSQSSSKRPKRSELDSYL 53