BLASTX nr result
ID: Anemarrhena21_contig00040474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00040474 (258 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008778287.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_002512699.1| pentatricopeptide repeat-containing protein,... 63 7e-08 ref|XP_004301045.1| PREDICTED: pentatricopeptide repeat-containi... 63 9e-08 ref|XP_010910564.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_002278166.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 emb|CAN82226.1| hypothetical protein VITISV_011875 [Vitis vinifera] 59 2e-06 ref|XP_011020921.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_012483355.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 >ref|XP_008778287.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Phoenix dactylifera] Length = 668 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Frame = -3 Query: 178 AHQPFDQVPLTNTFAWNSLLRSH-NNNNPFQSLLSLRSMLLAGFLPASRTLPLALTASRL 2 A+QP DQ+PL +TFAWNSLLR+H + N +Q++L R MLL G P TLP L AS L Sbjct: 52 AYQPLDQIPLRDTFAWNSLLRAHLVDGNCWQTILVYRHMLLCGVRPDRHTLPAVLRASGL 111 >ref|XP_002512699.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548660|gb|EEF50151.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 686 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = -3 Query: 172 QPFDQVPLTNTFAWNSLLRSH-NNNNPFQSLLSLRSMLLAGFLPASRTLPLALTASRL 2 QP D++PL++TFAWN+L+ SH N +PF +L MLL G LP RT P L ASRL Sbjct: 52 QPLDEIPLSDTFAWNNLIHSHLTNRDPFSALSIYLHMLLRGALPDRRTFPRVLNASRL 109 >ref|XP_004301045.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 656 Score = 62.8 bits (151), Expect = 9e-08 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%) Frame = -3 Query: 256 PLQCSSLPPVTQKTPTNAQTPKTHLLAHQPFDQVPLTNTFAWNSLLRSHNNNNPFQSLLS 77 P+ C+S Q+ N QTP+ LAH+ FD + ++T+AWN L+++H NN F +S Sbjct: 18 PINCAS----QQRHSRNVQTPRKVALAHRAFDGMSHSDTYAWNKLIQTHIANNDFHYAVS 73 Query: 76 -LRSMLLAGFLPASRTLPLALTASRL 2 ML G P TLP AL+ASRL Sbjct: 74 TYDQMLHRGVRPDRHTLPRALSASRL 99 >ref|XP_010910564.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Elaeis guineensis] Length = 669 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = -3 Query: 178 AHQPFDQVPLTNTFAWNSLLRSH-NNNNPFQSLLSLRSMLLAGFLPASRTLPLALTASRL 2 A+QP DQ+PL +TFAWNSLLR++ + N ++++L R MLL G P RTLP L AS L Sbjct: 53 AYQPLDQIPLRDTFAWNSLLRAYLVDGNSWKTILVYRHMLLCGARPDHRTLPAVLRASGL 112 >ref|XP_002278166.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Vitis vinifera] Length = 662 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/60 (46%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -3 Query: 181 LAHQPFDQVPLTNTFAWNSLLRSHNNNNPFQSLLS-LRSMLLAGFLPASRTLPLALTASR 5 L HQ FD++P++NTFAWN+L+++H N ++S R MLL G P T+P LTA+R Sbjct: 45 LTHQLFDEIPVSNTFAWNNLIQTHLTNGDSDRVVSTYRQMLLRGVRPDKHTIPRILTAAR 104 >emb|CAN82226.1| hypothetical protein VITISV_011875 [Vitis vinifera] Length = 734 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/60 (46%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -3 Query: 181 LAHQPFDQVPLTNTFAWNSLLRSHNNNNPFQSLLS-LRSMLLAGFLPASRTLPLALTASR 5 L HQ FD++P++NTFAWN+L+++H N ++S R MLL G P T+P LTA+R Sbjct: 140 LTHQLFDEIPVSNTFAWNNLIQTHLTNGDSGRVVSTYRQMLLRGVRPDKHTIPRILTAAR 199 >ref|XP_011020921.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Populus euphratica] Length = 666 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%) Frame = -3 Query: 208 NAQTPKTHLLAHQPFDQVPLTNTFAWNSLLRSH-NNNNPFQSLLSLRSMLLAGFLPASRT 32 +A+ P L H+ D+ PL++TFAWN+L+ +H +N +P +L M++ G P RT Sbjct: 37 SARFPGELALTHKVLDETPLSDTFAWNNLIHTHLSNRDPGGALSIYHHMMMRGACPDRRT 96 Query: 31 LPLALTASRL 2 LP LTASR+ Sbjct: 97 LPRVLTASRI 106 >ref|XP_012483355.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Gossypium raimondii] gi|763766015|gb|KJB33230.1| hypothetical protein B456_006G003200 [Gossypium raimondii] Length = 658 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = -3 Query: 181 LAHQPFDQVPLTNTFAWNSLLRSH-NNNNPFQSLLSLRSMLLAGFLPASRTLPLALTASR 5 LAH+ D++P +AWN L+++H +NN+P +L M+L G P TLP LTASR Sbjct: 40 LAHKVVDEIPQPKAYAWNQLIQTHLSNNHPHNALSVYHGMMLRGIRPDHHTLPRVLTASR 99 Query: 4 L 2 L Sbjct: 100 L 100