BLASTX nr result
ID: Anemarrhena21_contig00040277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00040277 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010918598.1| PREDICTED: phosphoglucan phosphatase DSP4, a... 71 3e-10 ref|XP_008803461.1| PREDICTED: phosphoglucan phosphatase DSP4, a... 67 5e-09 >ref|XP_010918598.1| PREDICTED: phosphoglucan phosphatase DSP4, amyloplastic isoform X1 [Elaeis guineensis] gi|743776385|ref|XP_010918599.1| PREDICTED: phosphoglucan phosphatase DSP4, amyloplastic isoform X1 [Elaeis guineensis] Length = 369 Score = 70.9 bits (172), Expect = 3e-10 Identities = 41/78 (52%), Positives = 48/78 (61%) Frame = +1 Query: 91 MNCLQNLLKLSAPPMGKAVKRHSERTPVLNMGMVRADRCGNIRMNAXXXXXXXXXXXXXX 270 MNCLQNL K APP+ A+K HS R P+LN+GMVR G+I MNA Sbjct: 1 MNCLQNLPKSRAPPL-HAMKNHSRRPPILNLGMVRGGLGGSIGMNA---FSVSASSTEKS 56 Query: 271 XXXVQEEKSEIYSNNMTE 324 VQ+EKSEIYSNNMT+ Sbjct: 57 DAEVQDEKSEIYSNNMTQ 74 >ref|XP_008803461.1| PREDICTED: phosphoglucan phosphatase DSP4, amyloplastic [Phoenix dactylifera] Length = 262 Score = 67.0 bits (162), Expect = 5e-09 Identities = 38/78 (48%), Positives = 48/78 (61%) Frame = +1 Query: 91 MNCLQNLLKLSAPPMGKAVKRHSERTPVLNMGMVRADRCGNIRMNAXXXXXXXXXXXXXX 270 MNCLQNL + A P+ A+K +S R P+LN+GM+R D GNI MNA Sbjct: 1 MNCLQNLPRSPAAPL-HAMKNNSRRPPILNLGMIRGDLGGNIGMNA---FSVSASSTEKS 56 Query: 271 XXXVQEEKSEIYSNNMTE 324 VQ+EKS+IYSNNMT+ Sbjct: 57 DAEVQDEKSDIYSNNMTQ 74