BLASTX nr result
ID: Anemarrhena21_contig00040188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00040188 (304 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM93391.1| hypothetical protein AMTR_s05614p00001110, partia... 66 1e-08 >gb|ERM93391.1| hypothetical protein AMTR_s05614p00001110, partial [Amborella trichopoda] Length = 509 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -3 Query: 287 QKETKYIVYGYAPALQYWAYEVIVEVEMNYGLKEGNRVPRMISWSS 150 Q E KY YG+APA+QYWAYE I+EV YG G R PRM+SW+S Sbjct: 90 QHECKYTAYGFAPAVQYWAYEAILEVGKRYGTNHGIRFPRMLSWTS 135