BLASTX nr result
ID: Anemarrhena21_contig00040040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00040040 (227 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009418723.1| PREDICTED: tRNA-dihydrouridine(16/17) syntha... 57 5e-06 >ref|XP_009418723.1| PREDICTED: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like [Musa acuminata subsp. malaccensis] Length = 430 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +2 Query: 2 EVREELNCQSKLTFEWLRAMVGRLRNLGGGVPLCHAPINT 121 +VREELN QSKLTFEWL MV RL+ LGGG+PL NT Sbjct: 382 QVREELNAQSKLTFEWLHDMVTRLKELGGGIPLYTEEANT 421