BLASTX nr result
ID: Anemarrhena21_contig00039475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00039475 (441 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010920159.1| PREDICTED: WD repeat-containing protein 25 [... 59 1e-06 ref|XP_008788412.1| PREDICTED: WD repeat-containing protein 25 [... 59 1e-06 >ref|XP_010920159.1| PREDICTED: WD repeat-containing protein 25 [Elaeis guineensis] Length = 438 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/39 (71%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = -1 Query: 123 VYGEAFTCPCARYQPSDACFIAQSNANYI*IL-ARLLFK 10 VY EA+TCPC RY PSDACF+AQSN NYI I AR FK Sbjct: 316 VYTEAYTCPCIRYHPSDACFVAQSNGNYIAIFSARAPFK 354 >ref|XP_008788412.1| PREDICTED: WD repeat-containing protein 25 [Phoenix dactylifera] Length = 442 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/39 (71%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = -1 Query: 123 VYGEAFTCPCARYQPSDACFIAQSNANYI*IL-ARLLFK 10 VY EA+TCPC RY PSDACF+AQSN NYI I AR FK Sbjct: 320 VYTEAYTCPCIRYHPSDACFVAQSNGNYIAIFSARAPFK 358