BLASTX nr result
ID: Anemarrhena21_contig00039348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00039348 (545 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588269.1| Mitochondrial protein, putative [Medicago tr... 62 2e-07 gb|KJB09789.1| hypothetical protein B456_001G166200 [Gossypium r... 60 7e-07 >ref|XP_003588269.1| Mitochondrial protein, putative [Medicago truncatula] gi|657370790|gb|KEH16851.1| hypothetical protein MTR_0082s0100 [Medicago truncatula] Length = 172 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 110 MYAIHLAGIVVQLVRAPPCQGGSCGFEPRQSRTRIR 217 ++ I + GIVVQ VRAPPCQGGSCGFEPRQSR RIR Sbjct: 137 VHLIFIPGIVVQSVRAPPCQGGSCGFEPRQSRPRIR 172 >gb|KJB09789.1| hypothetical protein B456_001G166200 [Gossypium raimondii] Length = 100 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +2 Query: 131 GIVVQLVRAPPCQGGSCGFEPRQSRTRIR 217 GIVVQ VRAPPCQGGSCGFEPRQSR RIR Sbjct: 72 GIVVQSVRAPPCQGGSCGFEPRQSRPRIR 100