BLASTX nr result
ID: Anemarrhena21_contig00039041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00039041 (660 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102911.1| E3 ubiquitin-protein ligase UPL6 [Morus nota... 58 5e-06 >ref|XP_010102911.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] gi|587906299|gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] Length = 1413 Score = 57.8 bits (138), Expect = 5e-06 Identities = 31/69 (44%), Positives = 41/69 (59%) Frame = +3 Query: 114 MLYRSKC*TIKK*RI*EMIVVENAKMD*WRGNTLRDRIRNKCI*RRSKIMPIEDKIREN* 293 MLY SKC IK+ I +M V E + G T DRI+N+ I + + PIEDK+RE Sbjct: 967 MLYGSKCWAIKRQHISKMSVAEMRMLRWMSGQTRMDRIKNEVIRSKVGVAPIEDKVREGR 1026 Query: 294 LKWFGQCKR 320 L+WFG +R Sbjct: 1027 LRWFGHVQR 1035