BLASTX nr result
ID: Anemarrhena21_contig00038890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00038890 (256 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010924666.1| PREDICTED: B3 domain-containing protein Os01... 74 4e-11 ref|XP_008810645.1| PREDICTED: B3 domain-containing protein Os01... 65 1e-08 ref|XP_009389369.1| PREDICTED: B3 domain-containing protein Os01... 65 2e-08 gb|EEC71407.1| hypothetical protein OsI_03573 [Oryza sativa Indi... 57 5e-06 ref|NP_001172546.1| Os01g0723500 [Oryza sativa Japonica Group] g... 57 5e-06 ref|XP_006644645.1| PREDICTED: B3 domain-containing protein Os01... 56 8e-06 >ref|XP_010924666.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Elaeis guineensis] Length = 352 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -2 Query: 147 GRGRQRDMAFRRKPHFFKVLLGDFAQRLKMPPNFLKHISKETSKTAILE 1 G+ +QR + RKPHFFKVLLGDFAQRLK+PPNF+KHIS ETS+ IL+ Sbjct: 3 GKRQQRCRSLVRKPHFFKVLLGDFAQRLKIPPNFMKHISMETSRKVILQ 51 >ref|XP_008810645.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform X1 [Phoenix dactylifera] Length = 353 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -2 Query: 147 GRGRQRDM-AFRRKPHFFKVLLGDFAQRLKMPPNFLKHISKETSKTAILE 1 G+ +QR RKPHFFKVLLGDF QRLK+PPNFLKHIS E S+ L+ Sbjct: 3 GKRQQRSSRTLVRKPHFFKVLLGDFGQRLKIPPNFLKHISMEASRRVTLQ 52 >ref|XP_009389369.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Musa acuminata subsp. malaccensis] Length = 353 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 114 RKPHFFKVLLGDFAQRLKMPPNFLKHISKETSKTAILE 1 RKPHFFKVLLGDFAQRL++PP FLKHIS SK AIL+ Sbjct: 16 RKPHFFKVLLGDFAQRLRIPPKFLKHISSVGSKKAILQ 53 >gb|EEC71407.1| hypothetical protein OsI_03573 [Oryza sativa Indica Group] Length = 401 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 114 RKPHFFKVLLGDFAQRLKMPPNFLKHISKETSKTA 10 R+PHFFKVL+GDF QRLK+PPNF KHI E S+ A Sbjct: 16 RRPHFFKVLVGDFKQRLKIPPNFCKHIPWEESRKA 50 >ref|NP_001172546.1| Os01g0723500 [Oryza sativa Japonica Group] gi|75159252|sp|Q8S2E6.1|Y1235_ORYSJ RecName: Full=B3 domain-containing protein Os01g0723500 gi|20160548|dbj|BAB89497.1| hypothetical protein [Oryza sativa Japonica Group] gi|255673640|dbj|BAH91276.1| Os01g0723500 [Oryza sativa Japonica Group] Length = 402 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 114 RKPHFFKVLLGDFAQRLKMPPNFLKHISKETSKTA 10 R+PHFFKVL+GDF QRLK+PPNF KHI E S+ A Sbjct: 17 RRPHFFKVLVGDFKQRLKIPPNFCKHIPWEESRKA 51 >ref|XP_006644645.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Oryza brachyantha] Length = 401 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -2 Query: 114 RKPHFFKVLLGDFAQRLKMPPNFLKHISKETSKTA 10 R+PHFFKVL+GDF QRLK+PPNF KHI E S A Sbjct: 17 RRPHFFKVLVGDFKQRLKIPPNFCKHIPWEESSKA 51