BLASTX nr result
ID: Anemarrhena21_contig00038239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00038239 (468 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010646822.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_010646821.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_010646933.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_011626235.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 >ref|XP_010646822.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X2 [Vitis vinifera] Length = 474 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 170 FQTKSNLLPYLSLLEKCTNLKHVNKIHAHAITLGLANFTYITSRILSF 27 F ++ LPYL LLE+C+++ + +I+AH ITLGLA FTYITSR+LSF Sbjct: 5 FWKSASDLPYLRLLERCSSMHELKQIYAHVITLGLARFTYITSRVLSF 52 >ref|XP_010646821.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Vitis vinifera] Length = 528 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 170 FQTKSNLLPYLSLLEKCTNLKHVNKIHAHAITLGLANFTYITSRILSF 27 F ++ LPYL LLE+C+++ + +I+AH ITLGLA FTYITSR+LSF Sbjct: 5 FWKSASDLPYLRLLERCSSMHELKQIYAHVITLGLARFTYITSRVLSF 52 >ref|XP_010646933.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 528 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 170 FQTKSNLLPYLSLLEKCTNLKHVNKIHAHAITLGLANFTYITSRILSF 27 F ++ LPYL LLE+C+++ + +I+AH ITLGLA FTYITSR+LSF Sbjct: 5 FWKSASDLPYLRLLERCSSMHELKQIYAHVITLGLARFTYITSRVLSF 52 >ref|XP_011626235.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Amborella trichopoda] Length = 542 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -2 Query: 149 LPYLSLLEKCTNLKHVNKIHAHAITLGLANFTYITSRILSF 27 LPYL LLE+CT +KH+ +IHAH I G A F+++ SRI++F Sbjct: 16 LPYLPLLERCTYMKHLKQIHAHTIITGFARFSFVISRIMAF 56