BLASTX nr result
ID: Anemarrhena21_contig00037977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00037977 (878 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD66815.1| orf174 (mitochondrion) [Beta vulgaris subsp. vul... 84 9e-14 emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] 79 4e-12 ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulg... 55 8e-08 >dbj|BAD66815.1| orf174 (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 174 Score = 84.3 bits (207), Expect = 9e-14 Identities = 47/98 (47%), Positives = 57/98 (58%), Gaps = 6/98 (6%) Frame = -1 Query: 278 VVYMKQLTPCFSHGLTLFHAEPPFFLIHRDKM*N*CQQFITEEGLTDRGSLTYTN----- 114 V++ +PCFSH LF PP K ++GLT+ GSLT TN Sbjct: 21 VIFENDKSPCFSHRTILFPTSPPSPRSTETKCRAGANSSSRKKGLTEPGSLTNTNLIENT 80 Query: 113 -IIEKNCFFSILFVITLLPKALSNRSDHVDIPSTQHRS 3 IIEKNC F IL + LLP+AL NRS+H+DIPSTQHRS Sbjct: 81 NIIEKNCLFCILSPVLLLPRALRNRSEHIDIPSTQHRS 118 >emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] Length = 142 Score = 79.0 bits (193), Expect = 4e-12 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -1 Query: 155 EEGLTDRGSLTYTNIIEKNCFFSILFVITLLPKALSNRSDHVDIPSTQHRS 3 ++GLT+ GSLT TNIIEKNC F IL + LLP+AL NRSDH+DIPSTQHRS Sbjct: 37 KKGLTEPGSLTNTNIIEKNCLFCILSPVPLLPRALRNRSDHIDIPSTQHRS 87 >ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435087|ref|YP_004222305.1| hypothetical protein BevumaM_p070 [Beta vulgaris subsp. maritima] gi|346683178|ref|YP_004842110.1| hypothetical protein BemaM_p065 [Beta macrocarpa] gi|9049278|dbj|BAA99288.1| orf114a (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905640|emb|CBJ14041.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439820|emb|CBJ17532.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500096|emb|CBX24914.1| hypothetical protein [Beta macrocarpa] gi|384977899|emb|CBL54123.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 114 Score = 54.7 bits (130), Expect(2) = 8e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 1 DDLCCVEGIST*SDRLLKAFGSNVITKSIEKKQFFSIIL 117 DDLCCVEGIS SDRL KA GS +SI+K+QFFSIIL Sbjct: 29 DDLCCVEGISICSDRLRKARGSKRTGESIQKRQFFSIIL 67 Score = 30.0 bits (66), Expect(2) = 8e-08 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +3 Query: 150 FFRNELLALVLHFVSVDQEE 209 FFR+ELLA HFVSVD+ E Sbjct: 85 FFRDELLAPARHFVSVDRGE 104