BLASTX nr result
ID: Anemarrhena21_contig00037707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00037707 (313 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM94693.1| hypothetical protein AMTR_s00011p00232900 [Ambore... 93 6e-17 >gb|ERM94693.1| hypothetical protein AMTR_s00011p00232900 [Amborella trichopoda] Length = 156 Score = 93.2 bits (230), Expect = 6e-17 Identities = 41/86 (47%), Positives = 63/86 (73%) Frame = -2 Query: 276 SLVCSYMNEENCTKEEAVNHLKRMTEDTFHELIHEWLKPSQVPHCCRRLMFEHGRGTCFF 97 S V YM +ENC+++EA+ HL + ++ F EL+HE+LKP+++PH C+RLMFE+ R FF Sbjct: 71 SAVTCYMKQENCSEKEALEHLGTVIDEAFEELVHEYLKPNRLPHACKRLMFEYSRIMQFF 130 Query: 96 LGDIISTPLTQRKRIKDAMEIMFSPV 19 G ST +QR RI++A++ +F+PV Sbjct: 131 YGTSDSTNSSQRDRIENAIDCLFTPV 156