BLASTX nr result
ID: Anemarrhena21_contig00037690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00037690 (383 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010907348.1| PREDICTED: R3H domain-containing protein 4 i... 64 3e-08 ref|XP_010907342.1| PREDICTED: R3H domain-containing protein 4 i... 64 3e-08 ref|XP_008790970.1| PREDICTED: R3H domain-containing protein 4 i... 64 4e-08 ref|XP_008790969.1| PREDICTED: R3H domain-containing protein 4 i... 64 4e-08 ref|XP_009411765.1| PREDICTED: uncharacterized protein LOC103993... 57 5e-06 >ref|XP_010907348.1| PREDICTED: R3H domain-containing protein 4 isoform X2 [Elaeis guineensis] Length = 248 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = -3 Query: 381 LLHGVCAFYNLISVTVTVPKGVXXXXXXXXXXKLGSREIPPSISLSGFLKMSKNGVL 211 LLHGVC FYNLISVTVT G KLGS+EIPP+++L FLKM+K+G+L Sbjct: 192 LLHGVCEFYNLISVTVTTATGAKQWKMTKIRKKLGSQEIPPNMTLVQFLKMAKDGLL 248 >ref|XP_010907342.1| PREDICTED: R3H domain-containing protein 4 isoform X1 [Elaeis guineensis] Length = 250 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = -3 Query: 381 LLHGVCAFYNLISVTVTVPKGVXXXXXXXXXXKLGSREIPPSISLSGFLKMSKNGVL 211 LLHGVC FYNLISVTVT G KLGS+EIPP+++L FLKM+K+G+L Sbjct: 194 LLHGVCEFYNLISVTVTTATGAKQWKMTKIRKKLGSQEIPPNMTLVQFLKMAKDGLL 250 >ref|XP_008790970.1| PREDICTED: R3H domain-containing protein 4 isoform X2 [Phoenix dactylifera] Length = 248 Score = 63.9 bits (154), Expect = 4e-08 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = -3 Query: 381 LLHGVCAFYNLISVTVTVPKGVXXXXXXXXXXKLGSREIPPSISLSGFLKMSKNGVL 211 LLHGVC FYNLISVTV+ G KLGS+EIPP+I+L FLKM+K+G+L Sbjct: 192 LLHGVCEFYNLISVTVSTAPGAKRWKITKIKKKLGSQEIPPNITLVQFLKMAKDGLL 248 >ref|XP_008790969.1| PREDICTED: R3H domain-containing protein 4 isoform X1 [Phoenix dactylifera] Length = 250 Score = 63.9 bits (154), Expect = 4e-08 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = -3 Query: 381 LLHGVCAFYNLISVTVTVPKGVXXXXXXXXXXKLGSREIPPSISLSGFLKMSKNGVL 211 LLHGVC FYNLISVTV+ G KLGS+EIPP+I+L FLKM+K+G+L Sbjct: 194 LLHGVCEFYNLISVTVSTAPGAKRWKITKIKKKLGSQEIPPNITLVQFLKMAKDGLL 250 >ref|XP_009411765.1| PREDICTED: uncharacterized protein LOC103993422 isoform X2 [Musa acuminata subsp. malaccensis] Length = 242 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/57 (47%), Positives = 38/57 (66%) Frame = -3 Query: 381 LLHGVCAFYNLISVTVTVPKGVXXXXXXXXXXKLGSREIPPSISLSGFLKMSKNGVL 211 LLHGVC FYNLIS+T ++ + K+G EIPP+I+L+ FL++SK+G L Sbjct: 186 LLHGVCEFYNLISITESIVRDAKLWKMTRIKKKMGCNEIPPNITLAQFLRLSKDGAL 242