BLASTX nr result
ID: Anemarrhena21_contig00037650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00037650 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008804966.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 ref|XP_009404775.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 >ref|XP_008804966.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Phoenix dactylifera] gi|672169844|ref|XP_008804967.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Phoenix dactylifera] gi|672169846|ref|XP_008804968.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Phoenix dactylifera] Length = 553 Score = 77.8 bits (190), Expect = 3e-12 Identities = 42/85 (49%), Positives = 59/85 (69%) Frame = -3 Query: 257 LFRGFCSKVESPELPSWFKFSKAEQSHDLNLDEDFVLPTQMESLEYKQNSSKTHEHRADV 78 LF GFC+ SPELP WFKF +AEQS ++ D+DFVLPT++E LE S++TH+ R DV Sbjct: 27 LFNGFCTY--SPELPDWFKFPQAEQSC-VDSDDDFVLPTKLEFLE-DSVSNRTHDCRTDV 82 Query: 77 KIMTQEITDPDVDEVSNILKANFMS 3 K+ + + D+D +S ILK+ + S Sbjct: 83 KVACHDSKNVDLDGISRILKSKYAS 107 >ref|XP_009404775.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Musa acuminata subsp. malaccensis] gi|694998470|ref|XP_009404783.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Musa acuminata subsp. malaccensis] Length = 562 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/88 (43%), Positives = 58/88 (65%), Gaps = 2/88 (2%) Frame = -3 Query: 260 NLFRGFCSKVESPELPSWFKFSKAEQSHDLNLDEDFVLPTQMESLEYKQNSSKTHEHRAD 81 +LF GFC+ + PELP WF++ + EQ+ ++ D+DFVLPT++E LE S K H+ R D Sbjct: 30 SLFSGFCNSADLPELPDWFRYPQGEQNF-VDSDDDFVLPTKLEFLEDSGCSLKAHDWRLD 88 Query: 80 VKIMTQEIT--DPDVDEVSNILKANFMS 3 + + +I D D+D + +ILK+NF S Sbjct: 89 YRRGSYDIDDGDSDLDTICSILKSNFTS 116