BLASTX nr result
ID: Anemarrhena21_contig00037605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00037605 (299 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010937762.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 >ref|XP_010937762.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Elaeis guineensis] Length = 660 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/60 (53%), Positives = 39/60 (65%) Frame = +1 Query: 1 LAKIPGCSWIEMTNGVQVFVTRDASNKRSKEIYVTXXXXXXXXXXXXYISRVEFDEESYC 180 LAKIPGCSW+E++NG+QVFV D SN+RS+EIYV Y+ E DEES C Sbjct: 601 LAKIPGCSWMEISNGLQVFVAGDTSNRRSEEIYVVLEGLVRLMREEGYVLSCELDEESDC 660