BLASTX nr result
ID: Anemarrhena21_contig00037509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00037509 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010909984.1| PREDICTED: serpin-ZXA [Elaeis guineensis] 57 6e-06 >ref|XP_010909984.1| PREDICTED: serpin-ZXA [Elaeis guineensis] Length = 390 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +3 Query: 99 MDLRESISNQSDFALRISRHVGSTLAAGSNLVLSPLSLHV 218 MDLRESI NQ+ F+LR+++HVGS AA +NL SPLS+HV Sbjct: 1 MDLRESIGNQTAFSLRLAKHVGSAAAADANLAFSPLSVHV 40