BLASTX nr result
ID: Anemarrhena21_contig00037246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00037246 (254 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009383019.1| PREDICTED: pentatricopeptide repeat-containi... 92 1e-16 ref|XP_008787991.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_010907125.1| PREDICTED: pentatricopeptide repeat-containi... 83 6e-14 ref|XP_010907123.1| PREDICTED: pentatricopeptide repeat-containi... 83 6e-14 emb|CDP18423.1| unnamed protein product [Coffea canephora] 65 1e-08 ref|XP_010025581.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_012078614.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_008351607.1| PREDICTED: pentatricopeptide repeat-containi... 56 8e-06 >ref|XP_009383019.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Musa acuminata subsp. malaccensis] Length = 877 Score = 92.4 bits (228), Expect = 1e-16 Identities = 42/65 (64%), Positives = 51/65 (78%) Frame = -3 Query: 252 KLGNLDEALRNLRLLNPSILDYNGMLYCYFKSGSVSIQRVAGIFQGLKRFGPCLNVWTFN 73 K GNL ++L LRLL PSILDYNG+LY Y +SG VS+ +A +F +KRFGPC NVWTFN Sbjct: 223 KAGNLTDSLNFLRLLVPSILDYNGLLYRYLRSGHVSVDALANLFAEMKRFGPCPNVWTFN 282 Query: 72 IIFNG 58 I+FNG Sbjct: 283 ILFNG 287 >ref|XP_008787991.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, mitochondrial-like [Phoenix dactylifera] Length = 761 Score = 91.3 bits (225), Expect = 2e-16 Identities = 43/84 (51%), Positives = 55/84 (65%) Frame = -3 Query: 252 KLGNLDEALRNLRLLNPSILDYNGMLYCYFKSGSVSIQRVAGIFQGLKRFGPCLNVWTFN 73 K GNL EAL LRL+ PS+LDYN +L+CY KSG V + + +F+G+KRFGP NVWTFN Sbjct: 106 KGGNLVEALDVLRLMEPSVLDYNALLHCYLKSGRVCVDELWKVFEGMKRFGPYPNVWTFN 165 Query: 72 IIFNGXXXXXXXXXXXXXLEDMCS 1 +FNG +E+MCS Sbjct: 166 ALFNGLCALGRLKDARFIVEEMCS 189 >ref|XP_010907125.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720-like isoform X2 [Elaeis guineensis] Length = 666 Score = 83.2 bits (204), Expect = 6e-14 Identities = 39/82 (47%), Positives = 51/82 (62%) Frame = -3 Query: 246 GNLDEALRNLRLLNPSILDYNGMLYCYFKSGSVSIQRVAGIFQGLKRFGPCLNVWTFNII 67 G L EAL LRL+ PS+LD N +L+CY KSG V + + +F+G+KR GP NVWTFN + Sbjct: 108 GYLVEALDALRLMEPSVLDCNALLHCYLKSGRVCVDELRKVFEGMKRIGPYPNVWTFNTL 167 Query: 66 FNGXXXXXXXXXXXXXLEDMCS 1 FNG +E+MCS Sbjct: 168 FNGMCTLGRLKDARFIVEEMCS 189 >ref|XP_010907123.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720-like isoform X1 [Elaeis guineensis] gi|743874615|ref|XP_010907124.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720-like isoform X1 [Elaeis guineensis] Length = 762 Score = 83.2 bits (204), Expect = 6e-14 Identities = 39/82 (47%), Positives = 51/82 (62%) Frame = -3 Query: 246 GNLDEALRNLRLLNPSILDYNGMLYCYFKSGSVSIQRVAGIFQGLKRFGPCLNVWTFNII 67 G L EAL LRL+ PS+LD N +L+CY KSG V + + +F+G+KR GP NVWTFN + Sbjct: 108 GYLVEALDALRLMEPSVLDCNALLHCYLKSGRVCVDELRKVFEGMKRIGPYPNVWTFNTL 167 Query: 66 FNGXXXXXXXXXXXXXLEDMCS 1 FNG +E+MCS Sbjct: 168 FNGMCTLGRLKDARFIVEEMCS 189 >emb|CDP18423.1| unnamed protein product [Coffea canephora] Length = 726 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 5/86 (5%) Frame = -3 Query: 246 GNLDEALRNLRLLN-----PSILDYNGMLYCYFKSGSVSIQRVAGIFQGLKRFGPCLNVW 82 G L +AL L ++ P++ DYN M+YCY KS V + ++ G+KRFGPC N Sbjct: 62 GCLKQALDTLSMMRCVPGKPTVYDYNSMIYCYLKSEHVLFDELVEVYNGMKRFGPCPNAL 121 Query: 81 TFNIIFNGXXXXXXXXXXXXXLEDMC 4 T+N + NG E+MC Sbjct: 122 TYNCLLNGMVKIGRLKYGIFVAEEMC 147 >ref|XP_010025581.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like [Eucalyptus grandis] gi|702450787|ref|XP_010025582.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like [Eucalyptus grandis] gi|629096307|gb|KCW62302.1| hypothetical protein EUGRSUZ_H04959 [Eucalyptus grandis] Length = 728 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 2/67 (2%) Frame = -3 Query: 252 KLGNLDEALRNLRLL--NPSILDYNGMLYCYFKSGSVSIQRVAGIFQGLKRFGPCLNVWT 79 +LG EAL ++ + P+ DYN ++Y Y KSG V ++ +AG++ G+ RFGP N T Sbjct: 73 QLGRALEALNSMGCVPGKPTAYDYNALMYRYLKSGDVVLEELAGVYHGMTRFGPAPNALT 132 Query: 78 FNIIFNG 58 FN + NG Sbjct: 133 FNTLLNG 139 >ref|XP_012078614.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Jatropha curcas] gi|802639968|ref|XP_012078615.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Jatropha curcas] gi|802639970|ref|XP_012078616.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Jatropha curcas] gi|643722533|gb|KDP32283.1| hypothetical protein JCGZ_13208 [Jatropha curcas] Length = 685 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/68 (39%), Positives = 43/68 (63%), Gaps = 5/68 (7%) Frame = -3 Query: 246 GNLDEALRNLRLLN-----PSILDYNGMLYCYFKSGSVSIQRVAGIFQGLKRFGPCLNVW 82 G+ +AL L + P++ D+N +++CYFKS +VS+Q + ++ +KRFGP N Sbjct: 46 GDFKQALYTLNFMGNISGKPTVYDFNKLMHCYFKSRNVSLQVLVELYLRMKRFGPSPNAL 105 Query: 81 TFNIIFNG 58 TFNI+ NG Sbjct: 106 TFNILCNG 113 >ref|XP_008351607.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Malus domestica] gi|658032216|ref|XP_008351608.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Malus domestica] gi|658032218|ref|XP_008351609.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Malus domestica] gi|658032220|ref|XP_008351610.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Malus domestica] gi|658032222|ref|XP_008351611.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Malus domestica] gi|658032224|ref|XP_008351612.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Malus domestica] gi|658032226|ref|XP_008351613.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Malus domestica] gi|658032228|ref|XP_008351614.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Malus domestica] Length = 714 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 5/68 (7%) Frame = -3 Query: 246 GNLDEALRNLRLLN-----PSILDYNGMLYCYFKSGSVSIQRVAGIFQGLKRFGPCLNVW 82 GN +AL +L + P++ D+N ++Y Y KS +V + V ++ G+KRFGP N Sbjct: 62 GNFAKALESLNSMGNVPGKPTVYDFNALVYSYLKSQTVLLDNVVQVYLGMKRFGPAPNAS 121 Query: 81 TFNIIFNG 58 TFN + NG Sbjct: 122 TFNALLNG 129