BLASTX nr result
ID: Anemarrhena21_contig00036804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00036804 (344 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281217.1| PREDICTED: heavy metal-associated isoprenyla... 60 6e-07 ref|XP_010027813.1| PREDICTED: heavy metal-associated isoprenyla... 59 1e-06 ref|XP_010261203.1| PREDICTED: heavy metal-associated isoprenyla... 58 2e-06 emb|CDP01410.1| unnamed protein product [Coffea canephora] 58 3e-06 >ref|XP_002281217.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Vitis vinifera] Length = 151 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 MGIGGTLEYLSELLSSGHKHKKRKQLQTVEL 3 MG+GGTLEYLS+L+SSGHKHKKRKQ QTVEL Sbjct: 1 MGVGGTLEYLSDLMSSGHKHKKRKQSQTVEL 31 >ref|XP_010027813.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Eucalyptus grandis] Length = 152 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 95 MGIGGTLEYLSELLSSGHKHKKRKQLQTVEL 3 MG+ GTLEYLS+L+SSGHKHK+RKQLQTVEL Sbjct: 1 MGVAGTLEYLSDLMSSGHKHKRRKQLQTVEL 31 >ref|XP_010261203.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Nelumbo nucifera] Length = 151 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 95 MGIGGTLEYLSELLSSGHKHKKRKQLQTVEL 3 MG+GGTLEY S L+SSGHKHKK+KQLQTVEL Sbjct: 1 MGVGGTLEYFSGLMSSGHKHKKKKQLQTVEL 31 >emb|CDP01410.1| unnamed protein product [Coffea canephora] Length = 151 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 95 MGIGGTLEYLSELLSSGHKHKKRKQLQTVEL 3 MG+ GTLEYLS+L+SSGHKHKK+KQ+QTVEL Sbjct: 1 MGVSGTLEYLSDLVSSGHKHKKKKQMQTVEL 31