BLASTX nr result
ID: Anemarrhena21_contig00035745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00035745 (320 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009412628.1| PREDICTED: SNF2 domain-containing protein CL... 68 2e-09 ref|XP_008776285.1| PREDICTED: SNF2 domain-containing protein CL... 67 5e-09 ref|XP_010937951.1| PREDICTED: SNF2 domain-containing protein CL... 62 2e-07 ref|XP_004958789.1| PREDICTED: SNF2 domain-containing protein CL... 62 2e-07 ref|XP_010229549.1| PREDICTED: SNF2 domain-containing protein CL... 57 5e-06 >ref|XP_009412628.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Musa acuminata subsp. malaccensis] Length = 1199 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +3 Query: 171 MMKQEL-HQKHPIDAVPFEAFYHGSWHGVNFISIKNGCISIQLNYHGSVI 317 M K+ L H HPI+ PFEA+YHGSWHGV+ ISI+NG +LNYHG++I Sbjct: 1 MSKRRLSHCSHPINGTPFEAYYHGSWHGVDHISIRNGSTFAKLNYHGTMI 50 >ref|XP_008776285.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Phoenix dactylifera] Length = 1211 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 198 HPIDAVPFEAFYHGSWHGVNFISIKNGCISIQLNYHGSVIE 320 HPIDA PFEAFYHGSWHG +SIK+G I +Q N+ GS++E Sbjct: 11 HPIDATPFEAFYHGSWHGTQHVSIKSGSIFVQFNHGGSMLE 51 >ref|XP_010937951.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform X1 [Elaeis guineensis] Length = 1211 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 198 HPIDAVPFEAFYHGSWHGVNFISIKNGCISIQLNYHGSVIE 320 HPID PFEAFY GSWHG +SIK G I +Q N+ GS++E Sbjct: 11 HPIDVTPFEAFYDGSWHGTKHVSIKTGSIFVQFNHGGSMLE 51 >ref|XP_004958789.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like [Setaria italica] Length = 1232 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +3 Query: 189 HQKHPIDAVPFEAFYHGSWHGVNFISIKNGCISIQLNYHGSVIE 320 H HPI AVPFEAF++GSWHGVN I I+NG + ++ + GS +E Sbjct: 8 HHNHPIGAVPFEAFHNGSWHGVNSIRIRNGSLFVKFVHSGSAVE 51 >ref|XP_010229549.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Brachypodium distachyon] Length = 1245 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = +3 Query: 198 HPIDAVPFEAFYHGSWHGVNFISIKNGCISIQLNYHGSVIE 320 HPI A PFEAF+HGSWHGVN I ++N + ++ Y GS +E Sbjct: 15 HPICATPFEAFHHGSWHGVNCIRVQNSRLFVRFVYSGSTVE 55