BLASTX nr result
ID: Anemarrhena21_contig00035612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00035612 (543 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010094319.1| Calmodulin-binding transcription activator 5... 56 8e-06 >ref|XP_010094319.1| Calmodulin-binding transcription activator 5 [Morus notabilis] gi|587866261|gb|EXB55739.1| Calmodulin-binding transcription activator 5 [Morus notabilis] Length = 1036 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 448 PAMLNGSECWVIKK*YI*KMSVVEMRMLRWMS 543 P ML GSECWVIK+ YI KMSV EMRMLRWMS Sbjct: 316 PTMLYGSECWVIKRQYICKMSVTEMRMLRWMS 347