BLASTX nr result
ID: Anemarrhena21_contig00034380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00034380 (548 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173468.1| hypothetical protein NitaMp131 [Nicotiana tabac... 73 7e-11 >ref|YP_173468.1| hypothetical protein NitaMp131 [Nicotiana tabacum] gi|56806633|dbj|BAD83534.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 202 Score = 73.2 bits (178), Expect = 7e-11 Identities = 39/101 (38%), Positives = 66/101 (65%), Gaps = 1/101 (0%) Frame = -2 Query: 520 LSIPSSDLLTEVLLNFALIEFDEEFQRVFPGLDYSRYLHEVFVSFPKTSSKTFERFEEQV 341 + IP + L+T+VL NF L +FD F++++P L Y RYL + +V FP S ++ ++ +E++ Sbjct: 94 VGIPHAGLITKVLYNFMLDDFDRGFKQLYPSLSYYRYLADCYVLFPLFSLQSEQQCKEEM 153 Query: 340 LSLFEKLNLDGKILSIVPGEGP-VPCYGSLVCVSQDGKIKV 221 S+ +L+LDG I +I+PG G V G L+ +S+D + V Sbjct: 154 NSILLELDLDGDITTILPGGGAHVTRDGRLIILSRDCSLHV 194