BLASTX nr result
ID: Anemarrhena21_contig00034229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00034229 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010095673.1| hypothetical protein L484_012245 [Morus nota... 74 3e-11 ref|YP_588424.1| hypothetical protein ZeamMp180 [Zea mays subsp.... 73 6e-11 dbj|BAG84633.1| hypothetical protein (mitochondrion) [Aegilops c... 70 4e-10 ref|YP_008992271.1| hypothetical protein Salmi_Mp005 (mitochondr... 60 6e-07 >ref|XP_010095673.1| hypothetical protein L484_012245 [Morus notabilis] gi|587872574|gb|EXB61812.1| hypothetical protein L484_012245 [Morus notabilis] Length = 80 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 5/50 (10%) Frame = +1 Query: 118 AVVSVTHRASLSSDWC-----RHLSQDRNDYPCPMGLHSSLNVVGYCSLP 252 AVVSVTH+ASLSS + R+LSQD NDYPCPMGLH SLNVVGYCSLP Sbjct: 23 AVVSVTHKASLSSVFLVLENGRNLSQDWNDYPCPMGLHPSLNVVGYCSLP 72 >ref|YP_588424.1| hypothetical protein ZeamMp180 [Zea mays subsp. mays] gi|40795108|gb|AAR91152.1| hypothetical protein (mitochondrion) [Zea mays] gi|413954228|gb|AFW86877.1| putative uncharacterized protein orf110-c [Zea mays] gi|413954267|gb|AFW86916.1| putative uncharacterized protein orf110-c [Zea mays] Length = 110 Score = 73.2 bits (178), Expect = 6e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 253 GEVNSTRRHSGMNVDPSGRDNHSGPGRGGDTSLS 152 GEV STRRHSGMNVDPSGRDNHSGPGRGGDTSLS Sbjct: 77 GEVKSTRRHSGMNVDPSGRDNHSGPGRGGDTSLS 110 >dbj|BAG84633.1| hypothetical protein (mitochondrion) [Aegilops crassa] Length = 113 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 253 GEVNSTRRHSGMNVDPSGRDNHSGPGRGGDTSLS 152 GEV STRRHSGMNVDPSG DNHSGPGRGGDTSLS Sbjct: 80 GEVKSTRRHSGMNVDPSGGDNHSGPGRGGDTSLS 113 >ref|YP_008992271.1| hypothetical protein Salmi_Mp005 (mitochondrion) [Salvia miltiorrhiza] gi|534292250|gb|AGU16542.1| hypothetical protein Salmi_Mp005 (mitochondrion) [Salvia miltiorrhiza] Length = 117 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 253 GEVNSTRRHSGMNVDPSGRDNHSGPGR 173 GEVNSTRRHSGM+VDPSGRDNHSGPGR Sbjct: 75 GEVNSTRRHSGMDVDPSGRDNHSGPGR 101