BLASTX nr result
ID: Anemarrhena21_contig00033886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00033886 (216 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008791083.1| PREDICTED: probable serine/threonine-protein... 68 2e-09 ref|XP_010929623.1| PREDICTED: probable serine/threonine-protein... 63 9e-08 >ref|XP_008791083.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 [Phoenix dactylifera] Length = 456 Score = 68.2 bits (165), Expect = 2e-09 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = -2 Query: 215 RKRTGKEEAQTTVSEIFSRPLKSTSIGLLMDLRRNTRIHRKTKGKELEVIRGAG 54 RK T KEE Q S R L+ +SIGLLMDLRRNTRIHR+TKGKELEV GAG Sbjct: 403 RKSTSKEEHQLAPSHSLMRSLRPSSIGLLMDLRRNTRIHRRTKGKELEVF-GAG 455 >ref|XP_010929623.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 [Elaeis guineensis] Length = 543 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/49 (65%), Positives = 35/49 (71%) Frame = -2 Query: 215 RKRTGKEEAQTTVSEIFSRPLKSTSIGLLMDLRRNTRIHRKTKGKELEV 69 RK KEE Q S R L+ +SIGLLMDLRRNTRIHR+TKGKE EV Sbjct: 490 RKSASKEEHQVAPSHALVRSLRPSSIGLLMDLRRNTRIHRRTKGKESEV 538