BLASTX nr result
ID: Anemarrhena21_contig00033777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00033777 (586 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19717.3| unnamed protein product [Vitis vinifera] 57 6e-06 ref|XP_003634369.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 6e-06 >emb|CBI19717.3| unnamed protein product [Vitis vinifera] Length = 132 Score = 57.0 bits (136), Expect = 6e-06 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = -1 Query: 415 MPQRGYVLIFVFWALLTLITPTLIFWSASAKANLVSQEEARSEMKARRMMVSLER 251 M R +VLIF FWA LT+ITPTL+ SASAK N + E +KARRMM L++ Sbjct: 16 MNGRTFVLIFCFWAFLTIITPTLVHLSASAKPNFDFKGEESDGLKARRMMGYLDK 70 >ref|XP_003634369.1| PREDICTED: cyclin-dependent kinase inhibitor 1C [Vitis vinifera] Length = 117 Score = 57.0 bits (136), Expect = 6e-06 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = -1 Query: 415 MPQRGYVLIFVFWALLTLITPTLIFWSASAKANLVSQEEARSEMKARRMMVSLER 251 M R +VLIF FWA LT+ITPTL+ SASAK N + E +KARRMM L++ Sbjct: 1 MNGRTFVLIFCFWAFLTIITPTLVHLSASAKPNFDFKGEESDGLKARRMMGYLDK 55