BLASTX nr result
ID: Anemarrhena21_contig00033748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00033748 (244 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW01680.1| 40S ribosomal protein S28 [Verruconis gallopava] 64 4e-08 emb|CCX32541.1| Similar to 40S ribosomal protein S28; acc. no. Q... 64 4e-08 ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 64 4e-08 gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina M... 64 4e-08 gb|ESA09102.1| hypothetical protein GLOINDRAFT_348832 [Rhizophag... 62 1e-07 ref|XP_007779255.1| 40S ribosomal protein S28 [Coniosporium apol... 62 1e-07 ref|XP_006668816.1| 40S ribosomal protein S28 [Cordyceps militar... 62 1e-07 gb|KKA26499.1| hypothetical protein TD95_004483 [Thielaviopsis p... 62 1e-07 dbj|GAN02856.1| 40S ribosomal protein S28 [Mucor ambiguus] 62 1e-07 dbj|GAN06444.1| 40S ribosomal protein S28 [Mucor ambiguus] 62 1e-07 gb|KHJ30071.1| putative 40s ribosomal protein s28 [Erysiphe neca... 62 1e-07 emb|CEJ00130.1| Putative 40S ribosomal protein S28 [Rhizopus mic... 62 1e-07 emb|CEG73809.1| Putative 40S ribosomal protein S28 [Rhizopus mic... 62 1e-07 gb|KEQ93274.1| hypothetical protein AUEXF2481DRAFT_41999 [Aureob... 62 1e-07 ref|XP_002839718.1| 40S ribosomal protein S28 [Tuber melanosporu... 62 1e-07 gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F... 62 1e-07 ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyen... 62 1e-07 gb|EPB92531.1| 30S ribosomal protein S28e [Mucor circinelloides ... 62 1e-07 gb|EPB86257.1| 40S ribosomal protein S28 [Mucor circinelloides f... 62 1e-07 gb|EPB81781.1| 30S ribosomal protein S28e [Mucor circinelloides ... 62 1e-07 >gb|KIW01680.1| 40S ribosomal protein S28 [Verruconis gallopava] Length = 68 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDTTRSIIRNVKGPVRENDILC Sbjct: 27 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >emb|CCX32541.1| Similar to 40S ribosomal protein S28; acc. no. Q10421 [Pyronema omphalodes CBS 100304] Length = 68 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDTTRSIIRNVKGPVRENDILC Sbjct: 27 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDTTRSIIRNVKGPVRENDILC Sbjct: 27 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gi|407924574|gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] gi|821064263|gb|KKY19538.1| putative 40s ribosomal protein s28 [Diplodia seriata] gi|821064801|gb|KKY20058.1| putative 40s ribosomal protein s28 [Diplodia seriata] Length = 68 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDTTRSIIRNVKGPVRENDILC Sbjct: 27 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >gb|ESA09102.1| hypothetical protein GLOINDRAFT_348832 [Rhizophagus irregularis DAOM 181602] gi|595487660|gb|EXX73330.1| ribosomal 40S subunit protein S28B [Rhizophagus irregularis DAOM 197198w] gi|595487661|gb|EXX73331.1| ribosomal 40S subunit protein S28B [Rhizophagus irregularis DAOM 197198w] Length = 67 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDD+TRSIIRNVKGPVRENDILC Sbjct: 26 TQVRVEFMDDSTRSIIRNVKGPVRENDILC 55 >ref|XP_007779255.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] gi|494826922|gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] Length = 68 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 +QVRVEFMDDTTRSIIRNVKGPVRENDILC Sbjct: 27 SQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >ref|XP_006668816.1| 40S ribosomal protein S28 [Cordyceps militaris CM01] gi|346325733|gb|EGX95330.1| 40S ribosomal protein S28 [Cordyceps militaris CM01] gi|701776040|gb|KGQ09995.1| 40S ribosomal protein S28 [Beauveria bassiana D1-5] Length = 68 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDD+TRSIIRNVKGPVRENDILC Sbjct: 27 TQVRVEFMDDSTRSIIRNVKGPVRENDILC 56 >gb|KKA26499.1| hypothetical protein TD95_004483 [Thielaviopsis punctulata] Length = 68 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDD TRSIIRNVKGPVRENDILC Sbjct: 27 TQVRVEFMDDNTRSIIRNVKGPVRENDILC 56 >dbj|GAN02856.1| 40S ribosomal protein S28 [Mucor ambiguus] Length = 79 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDT RSIIRNVKGPVRENDILC Sbjct: 38 TQVRVEFMDDTNRSIIRNVKGPVRENDILC 67 >dbj|GAN06444.1| 40S ribosomal protein S28 [Mucor ambiguus] Length = 121 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDT RSIIRNVKGPVRENDILC Sbjct: 80 TQVRVEFMDDTNRSIIRNVKGPVRENDILC 109 >gb|KHJ30071.1| putative 40s ribosomal protein s28 [Erysiphe necator] Length = 67 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 26 TQVRVEFMDDTTRSIIRNVKGPVREDDILC 55 >emb|CEJ00130.1| Putative 40S ribosomal protein S28 [Rhizopus microsporus] Length = 98 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDT RSIIRNVKGPVRENDILC Sbjct: 57 TQVRVEFMDDTNRSIIRNVKGPVRENDILC 86 >emb|CEG73809.1| Putative 40S ribosomal protein S28 [Rhizopus microsporus] gi|727152255|emb|CEG65983.1| Putative 40S ribosomal protein S28 [Rhizopus microsporus] gi|729698994|emb|CEJ03832.1| Putative 40S ribosomal protein S28 [Rhizopus microsporus] Length = 67 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDT RSIIRNVKGPVRENDILC Sbjct: 26 TQVRVEFMDDTNRSIIRNVKGPVRENDILC 55 >gb|KEQ93274.1| hypothetical protein AUEXF2481DRAFT_41999 [Aureobasidium subglaciale EXF-2481] Length = 60 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 19 TQVRVEFMDDTTRSIIRNVKGPVREDDILC 48 >ref|XP_002839718.1| 40S ribosomal protein S28 [Tuber melanosporum Mel28] gi|295635912|emb|CAZ83909.1| unnamed protein product [Tuber melanosporum] Length = 68 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 27 TQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F-4157] Length = 68 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 27 TQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|512199315|gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|751749436|gb|KIM97619.1| hypothetical protein OIDMADRAFT_20164 [Oidiodendron maius Zn] Length = 68 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 27 TQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >gb|EPB92531.1| 30S ribosomal protein S28e [Mucor circinelloides f. circinelloides 1006PhL] Length = 87 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDT RSIIRNVKGPVRENDILC Sbjct: 46 TQVRVEFMDDTNRSIIRNVKGPVRENDILC 75 >gb|EPB86257.1| 40S ribosomal protein S28 [Mucor circinelloides f. circinelloides 1006PhL] gi|758353337|dbj|GAN04558.1| 40S ribosomal protein S28 [Mucor ambiguus] Length = 68 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDT RSIIRNVKGPVRENDILC Sbjct: 27 TQVRVEFMDDTNRSIIRNVKGPVRENDILC 56 >gb|EPB81781.1| 30S ribosomal protein S28e [Mucor circinelloides f. circinelloides 1006PhL] Length = 101 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 244 TQVRVEFMDDTTRSIIRNVKGPVRENDILC 155 TQVRVEFMDDT RSIIRNVKGPVRENDILC Sbjct: 60 TQVRVEFMDDTNRSIIRNVKGPVRENDILC 89