BLASTX nr result
ID: Anemarrhena21_contig00033451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00033451 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009403157.1| PREDICTED: uncharacterized protein LOC103986... 67 6e-09 >ref|XP_009403157.1| PREDICTED: uncharacterized protein LOC103986787 [Musa acuminata subsp. malaccensis] Length = 86 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = -2 Query: 282 SLPQGYGRKIQAVRYYDGGHSFKPSAGEKIWAGREMAEMVMDYEEAGANTNPKSGVSLPS 103 S PQGYGR+I +++Y+ +S PS E GRE EM MDY E GANTNP++G S Sbjct: 19 SSPQGYGRRIHVMKHYEAWNSPVPSHKEDSRMGRETTEMEMDYPEPGANTNPRAGAIFGS 78 Query: 102 PP 97 PP Sbjct: 79 PP 80