BLASTX nr result
ID: Anemarrhena21_contig00033209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00033209 (359 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63135.1| Retrotransposon gag protein [Asparagus officinalis] 79 1e-12 gb|ABD63158.1| hypothetical protein 20.t00010 [Asparagus officin... 79 1e-12 gb|ABB55290.1| hypothetical protein 10.t00034 [Asparagus officin... 58 2e-06 >gb|ABD63135.1| Retrotransposon gag protein [Asparagus officinalis] Length = 926 Score = 79.0 bits (193), Expect = 1e-12 Identities = 32/56 (57%), Positives = 43/56 (76%) Frame = +1 Query: 190 IQDQIATLAQRDELLKVGITRPYPLEWDSAPYPATFKPPSLQSFDGTGSPSRHIYY 357 ++ ++ +A R EL + G+ RPYP EWD+APYP FK P+LQ FDGTGSP++HIYY Sbjct: 519 LEARLNAMANRSELREEGVIRPYPAEWDTAPYPPKFKAPTLQPFDGTGSPNQHIYY 574 >gb|ABD63158.1| hypothetical protein 20.t00010 [Asparagus officinalis] Length = 869 Score = 79.0 bits (193), Expect = 1e-12 Identities = 32/56 (57%), Positives = 43/56 (76%) Frame = +1 Query: 190 IQDQIATLAQRDELLKVGITRPYPLEWDSAPYPATFKPPSLQSFDGTGSPSRHIYY 357 ++ ++ +A R EL + G+ RPYP EWD+APYP FK P+LQ FDGTGSP++HIYY Sbjct: 577 LKARLNAIANRSELREEGVVRPYPAEWDTAPYPPKFKAPTLQPFDGTGSPNQHIYY 632 >gb|ABB55290.1| hypothetical protein 10.t00034 [Asparagus officinalis] Length = 355 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 6/80 (7%) Frame = +1 Query: 136 KAPHPTS------SGTMDASVLKGIQDQIATLAQRDELLKVGITRPYPLEWDSAPYPATF 297 K H TS T + ++ ++ +I L E+ + GI PYP EW+S PYP F Sbjct: 263 KEDHATSPRNRPKEDTGEDKKMRDLESKINALMSAQEVKRSGIPCPYPREWESIPYPTKF 322 Query: 298 KPPSLQSFDGTGSPSRHIYY 357 K + FDG GSP++H+ Y Sbjct: 323 KLINFTPFDGMGSPTQHLIY 342