BLASTX nr result
ID: Anemarrhena21_contig00032855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00032855 (339 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008781345.1| PREDICTED: pentatricopeptide repeat-containi... 41 2e-07 ref|XP_009408172.1| PREDICTED: pentatricopeptide repeat-containi... 42 7e-07 ref|XP_010935201.1| PREDICTED: pentatricopeptide repeat-containi... 42 1e-06 >ref|XP_008781345.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Phoenix dactylifera] Length = 427 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 18/45 (40%), Positives = 30/45 (66%) Frame = -3 Query: 295 DIAHFYCDLVDASSDRKLKDFHLECYGRIKVMCYLGKGPFECTVR 161 +I+ FYCDL++A S+R LKD L+ Y R++ M + P+E ++ Sbjct: 127 EISLFYCDLIEAFSERGLKDLALDFYFRLREMPCSRRKPYESMIK 171 Score = 40.4 bits (93), Expect(2) = 2e-07 Identities = 18/28 (64%), Positives = 23/28 (82%) Frame = -2 Query: 86 EYRMVIQVYGQFRSFDEMRRVIGNMEDA 3 E+R+V+Q YG+ SF EMRRV+G MEDA Sbjct: 200 EFRLVLQSYGKLGSFAEMRRVLGIMEDA 227 >ref|XP_009408172.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Musa acuminata subsp. malaccensis] Length = 430 Score = 42.4 bits (98), Expect(2) = 7e-07 Identities = 17/46 (36%), Positives = 31/46 (67%) Frame = -3 Query: 298 RDIAHFYCDLVDASSDRKLKDFHLECYGRIKVMCYLGKGPFECTVR 161 RD+A FYCDL++ S++ L+ LE Y R++ + + G+ P+E ++ Sbjct: 129 RDLALFYCDLIECFSEQGLEQPVLETYARLREVPFAGRRPYESMIK 174 Score = 37.4 bits (85), Expect(2) = 7e-07 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 86 EYRMVIQVYGQFRSFDEMRRVIGNMEDA 3 E+R VIQ YG+ EMRRV+G+MEDA Sbjct: 203 EFRSVIQSYGRSGLLSEMRRVVGSMEDA 230 >ref|XP_010935201.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17033 [Elaeis guineensis] Length = 434 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 20/46 (43%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = -3 Query: 295 DIAHFYCDLVDASSDRKLKDFHLECYGRI-KVMCYLGKGPFECTVR 161 +I+ FYCDL++A S+R LKDF L+ Y R+ ++ C + K P+E ++ Sbjct: 133 EISLFYCDLIEAFSERGLKDFALDFYSRLHEIPCSVRK-PYESMIK 177 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -2 Query: 86 EYRMVIQVYGQFRSFDEMRRVIGNMEDA 3 E+R+V+Q YG+ SF EM RV+G MEDA Sbjct: 206 EFRLVMQSYGKSGSFAEMSRVLGIMEDA 233