BLASTX nr result
ID: Anemarrhena21_contig00032612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00032612 (482 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009399399.1| PREDICTED: armadillo repeat-containing prote... 63 9e-08 ref|XP_010245435.1| PREDICTED: armadillo repeat-containing prote... 61 3e-07 ref|XP_009357804.1| PREDICTED: armadillo repeat-containing prote... 60 7e-07 ref|XP_008348587.1| PREDICTED: armadillo repeat-containing prote... 60 7e-07 ref|XP_008812344.1| PREDICTED: armadillo repeat-containing prote... 59 1e-06 ref|XP_007016276.1| ARM repeat superfamily protein isoform 1 [Th... 59 2e-06 ref|XP_011655146.1| PREDICTED: armadillo repeat-containing prote... 58 3e-06 ref|XP_011655143.1| PREDICTED: armadillo repeat-containing prote... 58 3e-06 ref|XP_008463140.1| PREDICTED: armadillo repeat-containing prote... 58 3e-06 ref|XP_008463134.1| PREDICTED: armadillo repeat-containing prote... 58 3e-06 ref|XP_010943894.1| PREDICTED: armadillo repeat-containing prote... 57 4e-06 ref|XP_008244519.1| PREDICTED: armadillo repeat-containing prote... 57 5e-06 ref|XP_007217553.1| hypothetical protein PRUPE_ppa022453mg [Prun... 57 5e-06 gb|ADE77524.1| unknown [Picea sitchensis] 57 6e-06 ref|XP_010093374.1| Armadillo repeat-containing protein 7 [Morus... 56 8e-06 ref|NP_001132765.1| hypothetical protein [Zea mays] gi|670392494... 56 8e-06 ref|XP_006478170.1| PREDICTED: armadillo repeat-containing prote... 56 8e-06 ref|XP_006478169.1| PREDICTED: armadillo repeat-containing prote... 56 8e-06 ref|XP_006441515.1| hypothetical protein CICLE_v10022503mg [Citr... 56 8e-06 ref|XP_006441514.1| hypothetical protein CICLE_v10022503mg [Citr... 56 8e-06 >ref|XP_009399399.1| PREDICTED: armadillo repeat-containing protein 7 [Musa acuminata subsp. malaccensis] gi|695024377|ref|XP_009399400.1| PREDICTED: armadillo repeat-containing protein 7 [Musa acuminata subsp. malaccensis] Length = 176 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTNDKRQAERTG+ GTPR QYLQ+LVT+F TNE Sbjct: 1 MFTNDKRQAERTGRRGTPRAQYLQELVTEFQNATNE 36 >ref|XP_010245435.1| PREDICTED: armadillo repeat-containing protein 7 [Nelumbo nucifera] gi|720091512|ref|XP_010245436.1| PREDICTED: armadillo repeat-containing protein 7 [Nelumbo nucifera] gi|720091515|ref|XP_010245437.1| PREDICTED: armadillo repeat-containing protein 7 [Nelumbo nucifera] Length = 178 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTND+RQAERTG+ GTPRVQYLQ+LV++F TT+E Sbjct: 1 MFTNDRRQAERTGRYGTPRVQYLQELVSEFQNTTDE 36 >ref|XP_009357804.1| PREDICTED: armadillo repeat-containing protein 7 [Pyrus x bretschneideri] gi|694352310|ref|XP_009357805.1| PREDICTED: armadillo repeat-containing protein 7 [Pyrus x bretschneideri] Length = 183 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNEAKCMD 177 MFTND+RQ ERTG+SGTPR+QYLQ+LVT F TT++ + + Sbjct: 1 MFTNDRRQEERTGRSGTPRLQYLQELVTRFQSTTDDEEAKE 41 >ref|XP_008348587.1| PREDICTED: armadillo repeat-containing protein 7-like [Malus domestica] Length = 183 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNEAKCMD 177 MFTND+RQ ERTG+SGTPR+QYLQ+LVT F TT++ + + Sbjct: 1 MFTNDRRQEERTGRSGTPRLQYLQELVTRFQSTTDDEEAKE 41 >ref|XP_008812344.1| PREDICTED: armadillo repeat-containing protein 7 [Phoenix dactylifera] gi|672184091|ref|XP_008812345.1| PREDICTED: armadillo repeat-containing protein 7 [Phoenix dactylifera] Length = 176 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTND+RQ ERTGK GTPRVQYLQ+LVT+F T+ E Sbjct: 1 MFTNDQRQLERTGKYGTPRVQYLQELVTEFQGTSKE 36 >ref|XP_007016276.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] gi|508786639|gb|EOY33895.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] Length = 178 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTND+RQ ERTGK GTPR+QYLQ+LV+ F TT+E Sbjct: 1 MFTNDQRQGERTGKYGTPRLQYLQELVSQFQNTTDE 36 >ref|XP_011655146.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Cucumis sativus] gi|778702162|ref|XP_011655147.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Cucumis sativus] Length = 166 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTND+RQAERTGK GTPR+QYLQ+LV +F +T++ Sbjct: 1 MFTNDQRQAERTGKYGTPRLQYLQELVNEFQSSTSQ 36 >ref|XP_011655143.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis sativus] gi|778702153|ref|XP_011655144.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis sativus] gi|778702156|ref|XP_011655145.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis sativus] Length = 176 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTND+RQAERTGK GTPR+QYLQ+LV +F +T++ Sbjct: 1 MFTNDQRQAERTGKYGTPRLQYLQELVNEFQSSTSQ 36 >ref|XP_008463140.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Cucumis melo] gi|659126358|ref|XP_008463141.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Cucumis melo] gi|659126360|ref|XP_008463142.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Cucumis melo] Length = 166 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTND+RQAERTGK GTPR+QYLQ+LV +F +T++ Sbjct: 1 MFTNDQRQAERTGKYGTPRLQYLQELVNEFQSSTSQ 36 >ref|XP_008463134.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] gi|659126346|ref|XP_008463135.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] gi|659126348|ref|XP_008463136.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] gi|659126350|ref|XP_008463137.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] gi|659126352|ref|XP_008463138.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] gi|659126354|ref|XP_008463139.1| PREDICTED: armadillo repeat-containing protein 7 isoform X1 [Cucumis melo] Length = 176 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTND+RQAERTGK GTPR+QYLQ+LV +F +T++ Sbjct: 1 MFTNDQRQAERTGKYGTPRLQYLQELVNEFQSSTSQ 36 >ref|XP_010943894.1| PREDICTED: armadillo repeat-containing protein 7 [Elaeis guineensis] Length = 176 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTND+RQ ERTGK GTPR QYLQ+LVT+F T+ E Sbjct: 1 MFTNDQRQLERTGKYGTPRAQYLQELVTEFQGTSKE 36 >ref|XP_008244519.1| PREDICTED: armadillo repeat-containing protein 7 [Prunus mume] Length = 179 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTN++RQ ERTG+SGTPR+QYLQ+LV+ F TT++ Sbjct: 1 MFTNERRQEERTGRSGTPRLQYLQELVSQFQNTTDD 36 >ref|XP_007217553.1| hypothetical protein PRUPE_ppa022453mg [Prunus persica] gi|462413703|gb|EMJ18752.1| hypothetical protein PRUPE_ppa022453mg [Prunus persica] Length = 179 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTN++RQ ERTG+SGTPR+QYLQ+LV+ F TT++ Sbjct: 1 MFTNERRQEERTGRSGTPRLQYLQELVSQFQNTTDD 36 >gb|ADE77524.1| unknown [Picea sitchensis] Length = 50 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTND+RQ +RTGK GT R QYLQ+LVT+F KT NE Sbjct: 1 MFTNDERQKQRTGKYGTSREQYLQELVTEFQKTPNE 36 >ref|XP_010093374.1| Armadillo repeat-containing protein 7 [Morus notabilis] gi|587864303|gb|EXB53968.1| Armadillo repeat-containing protein 7 [Morus notabilis] Length = 178 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTND+RQ ERTGK GTPR+QYLQ+LVT + NE Sbjct: 1 MFTNDRRQEERTGKYGTPRLQYLQELVTQIQNSNNE 36 >ref|NP_001132765.1| hypothetical protein [Zea mays] gi|670392494|ref|XP_008676634.1| PREDICTED: hypothetical protein isoform X1 [Zea mays] gi|194695338|gb|ACF81753.1| unknown [Zea mays] gi|238006382|gb|ACR34226.1| unknown [Zea mays] gi|413923648|gb|AFW63580.1| hypothetical protein ZEAMMB73_692312 [Zea mays] Length = 176 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNE 192 MFTN +RQ ERTG+SGTPR QYLQDLVT F T+E Sbjct: 1 MFTNAQRQVERTGRSGTPRDQYLQDLVTQFQNATDE 36 >ref|XP_006478170.1| PREDICTED: armadillo repeat-containing protein 7-like isoform X2 [Citrus sinensis] Length = 178 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNEAK 186 MFTN++RQ ERTG+SGTPR+QYLQ+LV+ F +T+E + Sbjct: 1 MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEER 38 >ref|XP_006478169.1| PREDICTED: armadillo repeat-containing protein 7-like isoform X1 [Citrus sinensis] Length = 182 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNEAK 186 MFTN++RQ ERTG+SGTPR+QYLQ+LV+ F +T+E + Sbjct: 1 MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEER 38 >ref|XP_006441515.1| hypothetical protein CICLE_v10022503mg [Citrus clementina] gi|557543777|gb|ESR54755.1| hypothetical protein CICLE_v10022503mg [Citrus clementina] gi|641837086|gb|KDO56043.1| hypothetical protein CISIN_1g030369mg [Citrus sinensis] Length = 128 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNEAK 186 MFTN++RQ ERTG+SGTPR+QYLQ+LV+ F +T+E + Sbjct: 1 MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEER 38 >ref|XP_006441514.1| hypothetical protein CICLE_v10022503mg [Citrus clementina] gi|557543776|gb|ESR54754.1| hypothetical protein CICLE_v10022503mg [Citrus clementina] gi|641837085|gb|KDO56042.1| hypothetical protein CISIN_1g030369mg [Citrus sinensis] Length = 178 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -1 Query: 299 MFTNDKRQAERTGKSGTPRVQYLQDLVTDFYKTTNEAK 186 MFTN++RQ ERTG+SGTPR+QYLQ+LV+ F +T+E + Sbjct: 1 MFTNNQRQEERTGRSGTPRLQYLQELVSQFQNSTDEER 38