BLASTX nr result
ID: Anemarrhena21_contig00032240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00032240 (655 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012435009.1| PREDICTED: mediator of RNA polymerase II tra... 46 3e-09 ref|XP_007029121.1| Mediator of RNA polymerase II transcription ... 46 4e-09 ref|XP_007029120.1| Mediator of RNA polymerase II transcription ... 46 4e-09 ref|XP_007029122.1| Mediator of RNA polymerase II transcription ... 46 4e-09 ref|XP_009350790.1| PREDICTED: mediator of RNA polymerase II tra... 46 5e-09 ref|XP_008366616.1| PREDICTED: mediator of RNA polymerase II tra... 46 5e-09 ref|XP_008391554.1| PREDICTED: mediator of RNA polymerase II tra... 46 5e-09 ref|XP_004303373.1| PREDICTED: mediator of RNA polymerase II tra... 46 5e-09 ref|XP_004136548.1| PREDICTED: mediator of RNA polymerase II tra... 46 5e-09 ref|XP_007225096.1| hypothetical protein PRUPE_ppa016436mg [Prun... 48 5e-09 ref|XP_010276344.1| PREDICTED: mediator of RNA polymerase II tra... 46 6e-09 ref|XP_010276345.1| PREDICTED: mediator of RNA polymerase II tra... 46 6e-09 gb|KCW90366.1| hypothetical protein EUGRSUZ_A02508 [Eucalyptus g... 45 6e-09 ref|XP_010276346.1| PREDICTED: mediator of RNA polymerase II tra... 46 6e-09 ref|XP_010087552.1| Putative mediator of RNA polymerase II trans... 46 7e-09 ref|XP_010276347.1| PREDICTED: mediator of RNA polymerase II tra... 46 7e-09 ref|XP_012090858.1| PREDICTED: mediator of RNA polymerase II tra... 46 7e-09 ref|XP_011039524.1| PREDICTED: mediator of RNA polymerase II tra... 46 7e-09 ref|XP_002323352.1| hypothetical protein POPTR_0016s06270g [Popu... 46 7e-09 ref|XP_010058503.1| PREDICTED: mediator of RNA polymerase II tra... 45 7e-09 >ref|XP_012435009.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a [Gossypium raimondii] gi|823199744|ref|XP_012435010.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a [Gossypium raimondii] gi|823199747|ref|XP_012435011.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a [Gossypium raimondii] gi|728845592|gb|KHG25035.1| Putative mediator of RNA polymerase II transcription subunit 7 [Gossypium arboreum] gi|763779236|gb|KJB46359.1| hypothetical protein B456_007G362800 [Gossypium raimondii] gi|763779237|gb|KJB46360.1| hypothetical protein B456_007G362800 [Gossypium raimondii] gi|763779238|gb|KJB46361.1| hypothetical protein B456_007G362800 [Gossypium raimondii] Length = 168 Score = 46.2 bits (108), Expect(2) = 3e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 71 KKELRSLNRELQLHILELADVLVERPS 97 Score = 42.4 bits (98), Expect(2) = 3e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARQVEEISLIFKNLHHLLNSLRPHQ 124 >ref|XP_007029121.1| Mediator of RNA polymerase II transcription subunit 7 isoform 2, partial [Theobroma cacao] gi|508717726|gb|EOY09623.1| Mediator of RNA polymerase II transcription subunit 7 isoform 2, partial [Theobroma cacao] Length = 185 Score = 46.2 bits (108), Expect(2) = 4e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 71 KKELRSLNRELQLHILELADVLVERPS 97 Score = 42.0 bits (97), Expect(2) = 4e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEEISLIFKNLHHLLNSLRPHQ 124 >ref|XP_007029120.1| Mediator of RNA polymerase II transcription subunit 7 isoform 1 [Theobroma cacao] gi|508717725|gb|EOY09622.1| Mediator of RNA polymerase II transcription subunit 7 isoform 1 [Theobroma cacao] Length = 173 Score = 46.2 bits (108), Expect(2) = 4e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 71 KKELRSLNRELQLHILELADVLVERPS 97 Score = 42.0 bits (97), Expect(2) = 4e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEEISLIFKNLHHLLNSLRPHQ 124 >ref|XP_007029122.1| Mediator of RNA polymerase II transcription subunit 7 isoform 3 [Theobroma cacao] gi|508717727|gb|EOY09624.1| Mediator of RNA polymerase II transcription subunit 7 isoform 3 [Theobroma cacao] Length = 168 Score = 46.2 bits (108), Expect(2) = 4e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 71 KKELRSLNRELQLHILELADVLVERPS 97 Score = 42.0 bits (97), Expect(2) = 4e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEEISLIFKNLHHLLNSLRPHQ 124 >ref|XP_009350790.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] gi|694451074|ref|XP_009350791.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] gi|694451078|ref|XP_009350792.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] Length = 175 Score = 45.8 bits (107), Expect(2) = 5e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL D+LV+RPS Sbjct: 71 KKELRSLNRELQLHILELADILVERPS 97 Score = 42.0 bits (97), Expect(2) = 5e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEEISLIFKNLHHLLNSLRPHQ 124 >ref|XP_008366616.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7b-like [Malus domestica] Length = 175 Score = 45.8 bits (107), Expect(2) = 5e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL D+LV+RPS Sbjct: 71 KKELRSLNRELQLHILELADILVERPS 97 Score = 42.0 bits (97), Expect(2) = 5e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEEISLIFKNLHHLLNSLRPHQ 124 >ref|XP_008391554.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Malus domestica] gi|657998309|ref|XP_008391555.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Malus domestica] gi|694415356|ref|XP_009335858.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] gi|694415359|ref|XP_009335859.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] gi|694415361|ref|XP_009335860.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Pyrus x bretschneideri] Length = 175 Score = 45.8 bits (107), Expect(2) = 5e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL D+LV+RPS Sbjct: 71 KKELRSLNRELQLHILELADILVERPS 97 Score = 42.0 bits (97), Expect(2) = 5e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEEISLIFKNLHHLLNSLRPHQ 124 >ref|XP_004303373.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Fragaria vesca subsp. vesca] Length = 175 Score = 45.8 bits (107), Expect(2) = 5e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL D+LV+RPS Sbjct: 71 KKELRSLNRELQLHILELADILVERPS 97 Score = 42.0 bits (97), Expect(2) = 5e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEEISLIFKNLHHLLNSLRPHQ 124 >ref|XP_004136548.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Cucumis sativus] gi|659084657|ref|XP_008443001.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Cucumis melo] gi|700204130|gb|KGN59263.1| hypothetical protein Csa_3G791540 [Cucumis sativus] Length = 168 Score = 45.8 bits (107), Expect(2) = 5e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL D+LV+RPS Sbjct: 71 KKELRSLNRELQLHILELADILVERPS 97 Score = 42.0 bits (97), Expect(2) = 5e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEEISLIFKNLHHLLNSLRPHQ 124 >ref|XP_007225096.1| hypothetical protein PRUPE_ppa016436mg [Prunus persica] gi|462422032|gb|EMJ26295.1| hypothetical protein PRUPE_ppa016436mg [Prunus persica] Length = 166 Score = 47.8 bits (112), Expect(2) = 5e-09 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 182 IYLLSFNKTLLRSLNRELQLHILELVDVLVQRPS 81 + L+ + K LRSLNRELQLHILEL D+LV+RPS Sbjct: 55 LVLIIYFKKELRSLNRELQLHILELADILVERPS 88 Score = 40.0 bits (92), Expect(2) = 5e-09 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYARS+E I L LHHLLNSL PHQ Sbjct: 89 QYARSVEDISLIFKNLHHLLNSLCPHQ 115 >ref|XP_010276344.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like isoform X1 [Nelumbo nucifera] Length = 200 Score = 46.2 bits (108), Expect(2) = 6e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 103 KKELRSLNRELQLHILELADVLVERPS 129 Score = 41.2 bits (95), Expect(2) = 6e-09 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E I L LHHLLNSLRPHQ Sbjct: 130 QYARRVEDISLIFKNLHHLLNSLRPHQ 156 >ref|XP_010276345.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like isoform X2 [Nelumbo nucifera] Length = 199 Score = 46.2 bits (108), Expect(2) = 6e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 103 KKELRSLNRELQLHILELADVLVERPS 129 Score = 41.2 bits (95), Expect(2) = 6e-09 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E I L LHHLLNSLRPHQ Sbjct: 130 QYARRVEDISLIFKNLHHLLNSLRPHQ 156 >gb|KCW90366.1| hypothetical protein EUGRSUZ_A02508 [Eucalyptus grandis] Length = 199 Score = 45.4 bits (106), Expect(2) = 6e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLH+LEL DVLV+RPS Sbjct: 71 KKELRSLNRELQLHLLELADVLVERPS 97 Score = 42.0 bits (97), Expect(2) = 6e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEEISLIFKNLHHLLNSLRPHQ 124 >ref|XP_010276346.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like isoform X3 [Nelumbo nucifera] Length = 187 Score = 46.2 bits (108), Expect(2) = 6e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 90 KKELRSLNRELQLHILELADVLVERPS 116 Score = 41.2 bits (95), Expect(2) = 6e-09 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E I L LHHLLNSLRPHQ Sbjct: 117 QYARRVEDISLIFKNLHHLLNSLRPHQ 143 >ref|XP_010087552.1| Putative mediator of RNA polymerase II transcription subunit 7 [Morus notabilis] gi|587838629|gb|EXB29325.1| Putative mediator of RNA polymerase II transcription subunit 7 [Morus notabilis] Length = 181 Score = 46.2 bits (108), Expect(2) = 7e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 71 KKELRSLNRELQLHILELADVLVERPS 97 Score = 41.2 bits (95), Expect(2) = 7e-09 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEDISLIFKNLHHLLNSLRPHQ 124 >ref|XP_010276347.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like isoform X4 [Nelumbo nucifera] Length = 170 Score = 46.2 bits (108), Expect(2) = 7e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 73 KKELRSLNRELQLHILELADVLVERPS 99 Score = 41.2 bits (95), Expect(2) = 7e-09 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E I L LHHLLNSLRPHQ Sbjct: 100 QYARRVEDISLIFKNLHHLLNSLRPHQ 126 >ref|XP_012090858.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a isoform X1 [Jatropha curcas] gi|643705364|gb|KDP21910.1| hypothetical protein JCGZ_03048 [Jatropha curcas] Length = 170 Score = 46.2 bits (108), Expect(2) = 7e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 71 KKELRSLNRELQLHILELADVLVERPS 97 Score = 41.2 bits (95), Expect(2) = 7e-09 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEDISLIFKNLHHLLNSLRPHQ 124 >ref|XP_011039524.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a isoform X1 [Populus euphratica] gi|743892032|ref|XP_011039526.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a isoform X2 [Populus euphratica] Length = 168 Score = 46.2 bits (108), Expect(2) = 7e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 71 KKELRSLNRELQLHILELADVLVERPS 97 Score = 41.2 bits (95), Expect(2) = 7e-09 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEDISLIFKNLHHLLNSLRPHQ 124 >ref|XP_002323352.1| hypothetical protein POPTR_0016s06270g [Populus trichocarpa] gi|222867982|gb|EEF05113.1| hypothetical protein POPTR_0016s06270g [Populus trichocarpa] Length = 168 Score = 46.2 bits (108), Expect(2) = 7e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLHILEL DVLV+RPS Sbjct: 71 KKELRSLNRELQLHILELADVLVERPS 97 Score = 41.2 bits (95), Expect(2) = 7e-09 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEDISLIFKNLHHLLNSLRPHQ 124 >ref|XP_010058503.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a [Eucalyptus grandis] gi|629125942|gb|KCW90367.1| hypothetical protein EUGRSUZ_A02508 [Eucalyptus grandis] Length = 168 Score = 45.4 bits (106), Expect(2) = 7e-09 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 161 KTLLRSLNRELQLHILELVDVLVQRPS 81 K LRSLNRELQLH+LEL DVLV+RPS Sbjct: 71 KKELRSLNRELQLHLLELADVLVERPS 97 Score = 42.0 bits (97), Expect(2) = 7e-09 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 Query: 81 QYARSIEKIPLFQNFLHHLLNSLRPHQ 1 QYAR +E+I L LHHLLNSLRPHQ Sbjct: 98 QYARRVEEISLIFKNLHHLLNSLRPHQ 124